close

Вход

Забыли?

вход по аккаунту

?

Реферат: Совгир Н. В.

код для вставкиСкачать
БЕЛОРУССКИЙ ГОСУДАРСТВЕННЫЙ УНИВЕРСИТЕТ
Выпускная работа по
«Основам информационных технологий
»
Магистрантки
кафедры микробиологии
Совгир Натальи Владимировны
Руководители:
доктор биологических наук, профессор
Прокулевич Владимир Антонович
старший преподаватель Шешко Сергей Михайлович
Минск - 2009
Оглавление
ОГЛАВЛЕНИЕ
.....................................................................................................................................................................
2
РЕФЕРАТ НА ТЕМУ:
.........................................................................................................................................................
3
ПЕРЕЧЕНЬ СОКРАЩЕНИЙ
............................................................................................................................................
4
ВВЕДЕНИЕ
...........................................................................................................................................................................
4
ГЛАВА 1. ОБЗОР ЛИТЕРАТУРЫ
....................................................................................................................................
6
1.1. К
ЛАССИФИКАЦИЯ
БИОЛОГИЧЕСКИХ
БАНКОВ
И
БАЗ
ДАННЫХ
.................................................................................................
7
1.2. Б
ИБЛИОГРАФИЧЕСКИЕ
БАЗЫ
ДАННЫХ
..............................................................................................................................
10
1.3. Б
АНКИ
И
БАЗЫ
ДАННЫХ
ПЕРВИЧНЫХ
ПОСЛЕДОВАТЕЛЬНОСТЕЙ
............................................................................................
11
ДНК, РНК И
БЕЛКОВ
........................................................................................................................................................
11
1.3.1. Нуклеотидные последовательности
.........................................................................................................
11
1.3.2. Аминокислотные последовательности
....................................................................................................
13
1.4. Б
АЗЫ
ДАННЫХ
ПРОСТРАНСТВЕННОЙ
СТРУКТУРЫ
..............................................................................................................
15
БИОЛОГИЧЕСКИХ
МАКРОМОЛЕКУЛ
..........................................................................................................................................
15
1.5. Г
ЕНОМНЫЕ
БАЗЫ
ДАННЫХ
.............................................................................................................................................
16
1.6. Т
ЕМАТИЧЕСКИЕ
БАНКИ
И
БАЗЫ
ДАННЫХ
..........................................................................................................................
19
1.7. П
РИМЕНЕНИЕ
ИЗВЕСТНЫХ
МЕТОДОВ
КОМПЬЮТЕРНОГО
.....................................................................................................
19
АНАЛИЗА
БИОЛОГИЧЕСКИХ
ДАННЫХ
.......................................................................................................................................
19
ГЛАВА 2. ОПЫТ РЕАЛИЗАЦИИ ИТ В СВОЕЙ ПРЕДМЕТНОЙ ОБЛАСТИ
.....................................................
21
2.1. Д
ИЗАЙН
ПРАЙМЕРОВ
ДЛЯ
ПЦР
.....................................................................................................................................
21
ЗАКЛЮЧЕНИЕ
..................................................................................................................................................................
24
СПИСОК ЛИТЕРАТУРЫ К РЕФЕРАТУ
.....................................................................................................................
26
ПРЕДМЕТНЫЙ УКАЗАТЕЛЬ К РЕФЕРАТУ
.............................................................................................................
27
ИНТЕРНЕТ РЕСУРСЫ В ПРЕДМЕТНОЙ ОБЛАСТИ ИССЛЕДОВАНИЯ
.........................................................
29
ДЕЙСТВУЮЩИЙ ЛИЧНЫЙ САЙТ В WWW
...........................................................................................................
35
ГРАФ (КРУГ) НАУЧНЫХ ИНТЕРЕСОВ
.....................................................................................................................
36
ПРЕЗЕНТАЦИЯ МАГИСТЕРСКОЙ ДИССЕРТАЦИИ
............................................................................................
39
СПИСОК ЛИТЕРАТУРЫ К ВЫПУСКНОЙ РАБОТЕ
..............................................................................................
40
ПРИЛОЖЕНИЕ A
..............................................................................................................................................................
42
2
РЕФЕРАТ НА ТЕМУ
:
«ИСПОЛЬЗОВАНИЕ ИНФОРМАЦИОННЫХ ТЕХНОЛОГИЙ В
МИКРОБИОЛОГИЧЕСКИХ И МОЛЕКУЛЯРНО-БИОЛОГИЧЕСКИХ
ИССЛЕДОВАНИЯХ»
Оглавление
ПЕРЕЧЕНЬ СОКРАЩЕНИЙ
....................................................
ERROR: REFERENCE SOURCE NOT FOUND
ВВЕДЕНИЕ
...................................................................................
ERROR: REFERENCE SOURCE NOT FOUND
ГЛАВА 1. ОБЗОР ЛИТЕРАТУРЫ
............................................
ERROR: REFERENCE SOURCE NOT FOUND
1.1. К
ЛАССИФИКАЦИЯ
БИОЛОГИЧЕСКИХ
БАНКОВ
И
БАЗ
ДАННЫХ
........................................
E
RROR
: R
EFERENCE
SOURCE
NOT
FOUND
1.2. Б
ИБЛИОГРАФИЧЕСКИЕ
БАЗЫ
ДАННЫХ
.......................................................................
E
RROR
: R
EFERENCE
SOURCE
NOT
FOUND
1.3. Б
АНКИ
И
БАЗЫ
ДАННЫХ
ПЕРВИЧНЫХ
ПОСЛЕДОВАТЕЛЬНОСТЕЙ
ДНК
, РНК
И
БЕЛКОВ
.........
E
RROR
: R
EFERENCE
SOURCE
NOT
FOUND
1.3.1. Нуклеотидные последовательности
.........................................................
Error: Reference source not found
1.3.2. Аминокислотные последовательности
.....................................................
Error: Reference source not found
1.4. Б
АЗЫ
ДАННЫХ
ПРОСТРАНСТВЕННОЙ
СТРУКТУРЫ
БИОЛОГИЧЕСКИХ
МАКРОМОЛЕКУЛ
........
E
RROR
: R
EFERENCE
SOURCE
NOT
FOUND
1.5. Г
ЕНОМНЫЕ
БАЗЫ
ДАННЫХ
.....................................................................................
E
RROR
: R
EFERENCE
SOURCE
NOT
FOUND
1.6. Т
ЕМАТИЧЕСКИЕ
БАНКИ
И
БАЗЫ
ДАННЫХ
..................................................................
E
RROR
: R
EFERENCE
SOURCE
NOT
FOUND
1.7. П
РИМЕНЕНИЕ
ИЗВЕСТНЫХ
МЕТОДОВ
КОМПЬЮТЕРНОГО
АНАЛИЗА
БИОЛОГИЧЕСКИХ
ДАННЫХ
E
RROR
: R
EFERENCE
SOURCE
NOT
FOUND
ГЛАВА 2. ОПЫТ РЕАЛИЗАЦИИ ИТ В СВОЕЙ ПРЕДМЕТНОЙ ОБЛАСТИ
........
ERROR: REFERENCE
SOURCE NOT FOUND
2.1. Д
ИЗАЙН
ПРАЙМЕРОВ
ДЛЯ
ПЦР
..............................................................................
E
RROR
: R
EFERENCE
SOURCE
NOT
FOUND
ЗАКЛЮЧЕНИЕ
............................................................................
ERROR: REFERENCE SOURCE NOT FOUND
СПИСОК ЛИТЕРАТУРЫ
..........................................................
ERROR: REFERENCE SOURCE NOT FOUND
ПРЕДМЕТНЫЙ УКАЗАТЕЛЬ
..................................................
ERROR: REFERENCE SOURCE NOT FOUND
3
Перечень сокращений
ДНК
Дезоксирибонуклеиновая кислота
кДНК
Комплементарная ДНК
ПЦР
Полимеразная цепная реакция
РНК
Рибонуклеиновая кислота
ЯМР Ядерный магнитный резонанс
Введение
В настоящее время биология, и микробиология, в частности, стала
производителем огромных объемов экспериментальных данных,
осмысливание которых невозможно без привлечения современных
информационных технологий
(ИТ) и эффективных математических методов
анализа данных и моделирования биологических систем и процессов.
В ответ на эту острую потребность возникает новое научное направление
- информационная биология, или биоинформатика
. Эта наука возникла в 1976-
1978 годах, но окончательно оформилась в 1980 году со специальным
выпуском журнала «Nucleic Acid Research» [5]. Основными задачами
биоинформатики являются:
1.
Разработка алгоритмов для анализа биологических данных
большого объема (например, алгоритма поиска генов в геноме).
2.
Анализ и интерпретация различных типов биологических данных
таких, как нуклеотидные и аминокислотные последовательности
, домены
белков
, структура белков и т.д. (например, изучение структуры активного
центра белка).
3.
Разработка программного обеспечения для управления и быстрого
доступа к биологическим данным (например, создание банка данных
аминокислотных последовательностей
).
Все эти задачи решаются при помощи: ·
базы данных
, в которых хранится биологическая информация;
4
·
набора инструментов для анализа тех данных, которые лежат в
таких базах;
·
правильного применения компьютерных методов.
Объектами исследований информационной биологии, таким образом,
являются генетические макромолекулы - ДНК
, РНК
, белки, а также
фундаментальные генетические процессы - репликация, транскрипция,
трансляция, генетические сети, функционирование которых обеспечивает
выполнение всех функций организмов [2].
Для современной микробиологии очень важен компьютерный анализ
нуклеиновых кислот: ДНК
и РНК
. Функциями нуклеиновых кислот являются
хранение, передача и воспроизведение генетической информации в ряду
поколений. Так, в ДНК любой клетки закодирована информация обо всех
белках
данного организма, о том, какие белки, в какой последовательности и в
каком количестве будут синтезироваться [1].
В настоящее время приобрело самые широкие масштабы секвенирование
ДНК
, которое позволяет довольно быстро определить полную нуклеотидную
последовательность сегмента длиной 100 - 500 пар оснований, образующегося
при расщеплении ДНК рестрикционными эндонуклеазами. В секвенированных
нуклеотидных последовательностях заключено огромное количество
информации, связанной с молекулярной генетикой различных живых
организмов. Для извлечения этой информации разрабатываются определенные
методы с целью решения самых разнообразных задач молекулярной генетики,
или как теперь говорят, геномики
. Созданы многочисленные программы
анализа нуклеотидных последовательностей
, которые сегодня являются
неотъемлемой частью многих биологических, в том числе
микробиологических, исследований и позволяют решать следующие задачи:
·
выравнивание и определение сходства двух последовательностей;
·
построение множественных выравниваний;
·
распознавание генов;
·
предсказание сайтов связывания регуляторных белков
;
5
·
предсказание вторичной структуры РНК
[
3
].
Исходя из всего вышесказанного, целью
моей работы является анализ
вклада достижений информатики в развитие микробиологии на основе
литературных данных и собственного опыта использования ИТ в научной
деятельности.
Задачи: 1.
охарактеризовать банки и базы данных
, используемых в
микробиологических и молекулярно-биологических исследованиях;
2.
на примере использования информационных технологий
в
собственных исследованиях показать важность ИТ при проведении
исследований живых объектов.
Глава 1. Обзор литературы
Термины "банк данных" и "база данных" являются очень близкими
синонимами для обозначения некоторого структурированного массива
информации. Предполагается, что банки данных
содержат информацию, с
которой можно производить достаточно ограниченное число манипуляций
(поиск, просмотр), в то время как базы данных
предоставляют возможность
какой-то специальной обработки информации (с помощью специально
написанных программ). Тем не менее, для простого пользователя не всегда
очевидна закономерность выбора между этими двумя близкими терминами в
том или ином случае. Поэтому банки и базы данных можно представлять как
одно и тоже, с исторически сложившимся отнесением конкретных массивов
информации либо к базам, либо к банкам данных
[10].
В настоящее время существуют сотни Web-сайтов, которые доступны
для обзора и поиска данных по молекулярной биологии, микробиологии и
другим смежным дисциплинам. Каждая из них имеет свой формат хранения
данных, различную степень избыточности, взаимосвязи с родственными или
аналогичными базами данных. Каждая база данных имеет также свои средства
доступа к информации - различные поисковые программы, программные
средства визуализации, пополнения базы. Крупнейшие хранилища первичных
6
структур ДНК
и аминокислотных последовательностей
(такие, как EMBL
,
GenBank
, DDBJ
, SWISS-PROT
, PIR
и др.) пополняются аннотированными
последовательностями непосредственно исследователями, расшифровавшими
их, с помощью автоматизированной системы пополнения баз данных
по сети
Интернет. Конечно, впоследствии эти данные проверяются персоналом
администраций баз данных и существенно пополняются. Вторым основным
источником информации во всех базах является специальная научная
литература. Многие базы данных, работающие над коллекционированием
однородной информации, координируют свои усилия, осуществляя
международное разделение труда, это можно проиллюстрировать примером
сотрудничества трех всемирных коллекций последовательностей нуклеотидов
EMBL (Европа), GenBank (США), DDBJ (Япония) [7].
Наряду с общими базами данных в последнее время появилось много
специализированных информационных ресурсов. Многие из них хранят
данные, полученные с помощью компьютерных методов, результаты
теоретических предсказаний. Большую роль в биоинформатике
играют
хранилища последовательностей ДНК
и кДНК
, специализированные базы
данных
по отдельным регуляторным мотивам нуклеотидных
последовательностей
, базы данных по экспрессии генов, библиотеки геномов,
карт, последовательностей РНК
, белков
, белковых мотивов, по продукции
белков [4]. Есть базы данных по протеомике, структурам белков, мутациям,
метаболическим путям и регуляции, по трансгеннным организмам, анатомии,
биохимии, а также по научной литературе, по существующему в этих областях
исследований программному обеспечению. Для того чтобы обеспечить
ориентирование в этом обширном информационном пространстве, журнал
«Nucleic Acids Research» в течение ряда последних лет первый номер года
посвящает описаниям баз данных, сделанным их авторами [7].
1.1. Классификация биологических банков и баз данных
Теперь, хотелось бы более подробно рассмотреть наиболее часто
используемые в микробиологических и молекулярно-биологических
7
исследованиях современные банки и базы данных
. Их можно
классифицировать по содержащейся в них информации на:
·
библиографические;
·
первичных последовательностей ДНК
, РНК
, белков
;
·
пространственной структуры молекул;
·
геномные;
·
тематические.
В мире существует лишь несколько крупных центров, поддерживающих
базы данных
первых четырех типов, и большое количество организаций,
содержащих базы данных по определенным темам (например, база данных по
рибосомальным генам или классификации ферментов, по мутациям гена p53
или белкам
Saccharomyces cerevisiae
и т.д.).
Основной тенденцией в развитии современных биологических баз
данных
можно назвать стремление к их интеграции, созданию перекрестных
ссылок между ними (например, между библиографической ссылкой на статью,
описывающую какой-то ген, и собственно нуклеотидной последовательностью
этого гена). Такой подход позволяет быстро находить и получать
исчерпывающую информацию по определенной теме.
Для поиска и получения необходимой информации из биологических баз
данных
существует специально разработанное программное обеспечение. Как
правило, поставщик базы данных предоставляет и необходимый для работы с
этой базой инструментарий. Кроме этого, некоторые базы данных могут иметь
копии (например, библиографическая база данных MEDLINE
), доступ к
которым через свои интерфейсы
предлагают независимые организации [10].
Среди интерфейсов
, предназначенных для работы с такими
интегрированными банками данных, следует выделить следующие.
WWW Entrez retrieval system
по праву можно считать примером для
подражания среди средств работы с банками и базами данных в Интернет. Эта
поисковая система создана в National Center for Biotechnology Information
8
(NCBI) и предназначена для работы с интегрированными базами данных,
находящимися в NCBI, которые содержат:
·
последовательности ДНК
из GenBank
, EMBL
и DDBJ
·
последовательности белков
из SWISS-PROT
, PIR
, PRF, PDB
, а так
же аминокислотные последовательности
, транслированные из нуклеотидных;
·
данные по картированию геномов и отдельных хромосом;
·
информацию о третичной структуре белков
(MMDB
);
·
библиографические ссылки из MEDLINE
и pre-MEDLINE.
Кроме WWW Entrez существует еще Network Entrez
- это клиент-
программа, которая устанавливается на локальном компьютере и обеспечивает
те же функции, что и WWW версия, но делает это немного быстрее.
PubMed
так же разрабатывается в NCBI
с целью создания
интегрированного доступа не только к MEDLINE
, но и к ресурсам,
предоставляемым издателями журналов, цитируемых в MEDLINE. Кроме
этого, PubMed предоставляет доступ к тем же молекулярно-биологическим
базам данных
, что и Entrez. В настоящее время интерфейс PubMed лишь
незначительно отличается от Entrez и имеет точно такие же принципы работы.
SRS
(Sequence Retrieval System) разработана в EMBL
для работы с
большим набором банков данных
. По сравнению с Entrez это более сложная
для освоения программаПоэтому SRS представляет интерес в основном для
специалистов, которые проводят достаточно много времени, работая с банками
данных [7].
Кроме этого, существует множество других структур, предоставляющих
доступ к различным биологическим ресурсам в Интернет, в том числе и к
базам данных
. Ниже перечислены некоторые из них.
BioMedNet
- WWW клуб биологического и медицинского сообщества.
Среди разнообразных услуг предлагается и очень хороший интерфейс для
работы с MEDLINE
(Evaluated Medline).
HealthGate
- поиск информации в MEDLINE
и других
библиографических базах данных
(AIDSLINE, CANCERLIT и т.д.) [10].
9
1.2. Библиографические базы данных
В библиографических базах данных
содержится информация о статьях,
публикуемых в реферируемых журналах. Эта информация обычно включает в
себя название статьи, имена авторов, название, год, выпуск и страницы
журнала, ключевые слова, а так же резюме (abstract) статьи в том виде, в каком
оно было напечатано в журнале.
Предшественниками современных электронных библиографических баз
данных
являются печатные реферативные журналы. И хотя реферативные
журналы издаются в традиционном бумажном варианте и сегодня, для
практического применения гораздо удобнее их электронные версии. Это
объясняется тем огромным преимуществом в скорости и качестве поиска
информации, которое обеспечивается компьютерной обработкой данных.
Практически все библиографические базы данных
распространяются на
компакт-дисках. Кроме этого, к большинству из этих баз данных также
обеспечивается доступ через Интернет, что позволяет работать с самой
последней, "горячей" информацией (хотя следует учитывать, что запись о
статье появляется в базе данных не сразу после ее публикации в журнале; в
зависимости от журнала и базы данных на публикацию статьи может уйти от
нескольких дней до нескольких месяцев).
Крупнейшей в мире библиографической базой данных является
Chemical Abstracts
, содержащая информацию из многих областей науки.
Через Интернет Chemical Abstracts предоставляет доступ к более чем 190
специализированным базам данных
, среди которых наибольший интерес для
биологов представляют BIOSISи MEDLINE
BIOSIS
- организация, разрабатывающая базы данных
, включающие в
себя всю библиографию биологической и биомедицинской тематики. В
печатном
виде
и
на
компакт
-
дисках
BIOSIS издает
Biological Abstracts, Biolo
-
gical Abstracts/RPM (Reports, Review, Meetings), Zoological Abstracts и
пр
.
Непосредственного доступа через Интернет к своим продуктам BIOSIS не
10
предоставляет. Электронные варианты доступны для использования через
посредников, таких как Chemical Abstracts
, KR SinceBase, и др [7].
MEDLINE
(MEDical literature analysis and retrieval system onLINE) - база
данных, разработанная National Lybrary of Medicine, которая содержит
библиографические ссылки (автор, название, журнал и резюме) в области
медицины, молекулярной биологии и биохимии. Таким образом, для
большинства биологов, работающих в области молекулярной биологии или
генетики, MEDLINE сегодня является первым и наиболее удобным
источником библиографической информации. Кроме этого, MEDLINE
интегрирована с другими базами данных, что делает ее использование весьма
эффективным. Существует несколько удобных WWW интерфейсов
для работы с
MEDLINE
. Среди них в первую очередь рекомендуются WWW Entrez и
PubMed
. Из прочих интерфейсов следует выделить BioMedNet
и HealthGate
.
Все из перечисленных интерфейсов
имеют подробные инструкции по
использованию, которые настоятельно рекомендуется изучить для
эффективного использования системы [8].
1.3. Банки и базы данных
первичных последовательностей
ДНК
, РНК
и белков
Все описанные в научной литературе последовательности ДНК
и белков
аннотируются в специальных базах данных
, открытых для публичного
доступа. Создание и поддержание качественных баз данных биологических
последовательностей - дело достаточно трудоемкое, так как необходима
тщательная структуризация данных и обработка больших массивов
информации, а также очень ответственное, в связи с тем, что этой
информацией пользуется все мировое сообщество биологов и медицинских
работников.
1.3.1. Нуклеотидные последовательности
В настоящее время существует четыре центра, поддерживающих базы
данных
, включающие все известные последовательности ДНК
и РНК
:
11
·
National Center for Biotechnology Information
(NCBI) содержит
банк
данных
GenBank
;
·
European Bioinformatics Institute (EBI) содержит
банк
данных
EMBL
; ·
Center for Informatio Biology (CIB) содержит
DNA Databank of Ja
-
pan
(DDBJ).
Все три банка ежедневно обмениваются поступающими в них данными,
и поэтому эти банки данных
можно считать практически равнозначными по
содержащейся в них информации (хотя есть и отличия, главным образом в
формате представляемых данных).
В настоящее время все научные журналы, публикующие статьи, в
которых речь идет о последовательностях ДНК
, требуют, чтобы эти
последовательности еще до публикации статьи были помещены в один из трех
вышеупомянутых банков данных
. Каждой новой последовательности ДНК в
банке данных приписывается уникальный номер, который и нужно приводить
в статье. Сами последовательности ДНК печатаются в журналах только тогда,
когда без этого невозможно обойтись [8].
Таким образом, каждая новая последовательности ДНК
неизбежно
попадает в GenBank
, EMBL
или DDBJ
, а после обмена информацией между
этими банками появляется в каждом из них. Именно это позволяет говорить о
существовании глобальной базы данных
нуклеотидных последовательностей
. Рассмотрим каждую базу данных более подробно.
GenBank
- банк данных генетических последовательностей,
аннотированная коллекция всех общедоступных последовательностей ДНК
,
РНК
и белков
, снабженных литературными ссылками, различной
биологической информацией. Обновляется каждые два месяца. NCBI
постоянно совершенствует и создает новые средства для депонирования новых
последовательностей в базу, средства эффективного поиска в базе.
Содержимое банка удваивается в объеме каждые 18 месяцев. При этом поиск
12
ДНК и белков не ограничивается только ресурсами GenBank
, но и другими
доступными по сети хранилищами информации.
EMBL
(
T
he EMBL Nucleotide Sequence Data
b
ase) - банк данных
нуклеотидных последовательностей
, которая пополняется большей частью
непосредственно авторами, определившими первичную структуру фрагмента
ДНКили РНК
и, кроме последовательности нуклеотидов, содержит
разнообразную информацию о каждом фрагменте, включая литературные
ссылки, перекрестные ссылки на документы других баз данных
, таблицы
особенностей и др. Существует с 1982 года.
Банк данных
DDBJ
(
DNA
DataBank
of
Japan
) создан в 1984 в рамках
программы создания международных банков данных
по ДНК
. DDBJ
предназначен для сбора последовательностей, в первую очередь, у японских
ученых, но кроме этого занимается сбором информации из научной
литературы. 75% данных, собранных в банке, представляют собой частично
секвенированные фрагменты ДНК из нескольких сотен экспрессированных
генов, называемых EST
(
Expressed
Sequence
Tags
) [7].
Последовательности в банках данных
обязательно сопровождаются
аннотацией, в которой содержится вся известная биологическая информация
относительно этой последовательности (организм, кодируемый белок,
положение инициирующего и терминирующего кодонов, интронов, экзонов и
т.д.), а также имя автора, название публикации, журнал, год, выпуск, страницы
и пр. Вся эта информация используется при поиске последовательностей в
банках данных. Значение биологической части аннотации трудно недооценить,
ведь именно информация о последовательностях позволяет систематизировать
накапливаемые данные.
1.3.2. Аминокислотные последовательности
Аминокислотные последовательности получают прямым пептидным
сиквенсом или путем трансляции открытых рамок считывания из банков
данных
нуклеотидных последовательностей
. Все последовательности ДНК
,
для которых известна кодирующая часть, автоматически после попадания в
13
банк данных транслируются в аминокислотные последовательности
, которые
депонируются в специальных банках данных. Как и для последовательностей
ДНК, для аминокислотных последовательностей создаются подробные
аннотации, описывающие пептид, а также содержащие ссылки на исходную
нуклеотидную последовательность, библиографические данные и пр. Банки
данных аминокислотных последовательностей, так же как и нуклеотидных,
интегрированы со множеством других баз данных
, т.е. содержат перекрестные
ссылки [10].
Аминокислотные последовательности содержатся в нижеперечисленных
базах данных
.
SWISS-PROT
- база данных, содержащая аннотированные
аминокислотные последовательности
, транслированные с нуклеотидных
последовательностей
EMBL
; адаптированные последовательности из PIR
; а
также последовательности, опубликованные в литературе и присланные
непосредственно самими авторами. Последовательность помещается в SWISS-
PROT только в случае, если имеется достаточно информативное описание
кодируемого ею пептида. Содержит высококачественные неизбыточные
аннотации, перекрестные ссылки на другие родственные базы данных
(EMBL,
Prosite, PDB
). Каждая аннотация содержит описание функции белка, его
доменной структуры, особенностей пострансляционной модификации,
различные варианты. Имеется неаннотированное приложение (T
R
EMBL
).
TREMBL
(TRanslated from EMBL
) – база данных, в которую
помещаются последовательности, кодирующие недостаточно описанные
пептиды, для того чтобы обеспечить доступ к последовательности до тех пор,
пока не накопится достаточно информации для перевода этой
последовательности в SWISS-PROT
. База данных
PIR
(International Protein Sequence Database) содержит
последовательности, транслированные из GenBank
или полученные прямым
пептидным сиквенсом.
14
PRF/SEQDB
(Protein Research Foundation p
eptide/Protein S
EQ
uence Data
-
B
ase) – база данных, также содержащая последовательности белков
и
пептидов, включая транслированные из нуклеотидных последовательностей
.
Каждая из вышеперечисленных баз данных
имеет свой WWW интерфейс
для доступа. Это Entrez или PubMed
для GenBank
, Maestro для GSDB, SRS
для
EMBL
, TREMBL
, SWISS-PROT
и т.д. Все интерфейсы
интуитивно понятны,
тем не менее, рекомендуется изучить инструкции по использованию, которые
имеются для каждой из перечисленных систем [7].
1.4. Базы данных пространственной структуры биологических макромолекул
Информация о пространственной организации белков
и ДНК
является
очень важной для понимания механизмов работы макромолекул и их
биологической функции. Третичную структуру макромолекул можно
определить экспериментальными методами (кристаллография, ЯМР). Эти
методы являются чрезвычайно трудоемкими и требуют больших затрат
времени, но позволяют получить достоверные сведения о пространственной
организации молекул.
В настоящее время большие усилия прилагаются для разработки методов
предсказания третичной структуры молекул на основе известной первичной
структуры. Тем не менее, экспериментальные методы пока остаются
единственно достоверными для определения третичной структуры
макромолекул.
Для хранения и систематизации данных о третичной структуре молекул,
полученных экспериментально, были созданы специальные банки и базы
данных
, описанные ниже.
PDB
(Protein DataBank) - коллекция экспериментально определенных
3D-структур биологических макромолекул. Раньше содержала и теоретические
модели, но начиная с июля 2002 года в основном депозитарии хранятся только
экспериментально определенные структуры (рентгеноструктурным, ядерно-
15
агнитнорезонансным и др. методами). Теоретические структуры выделены в
отдельную подбазу, которая доступна для перекачки по FTP.
База данных MMDB
(Molecular Modelling Data
B
ase) содержит
экспериментально определенные пространственные структуры белков
.
Большинство 3D-структур получено путем рентгеноструктурной
кристаллографии и ЯМР-спектроскопии, они дают информацию о
биологической функции, механизмах, связанных с этой функцией,
эволюционной истории и взаимосвязях между макромолекулами. Является
подмножеством PDB
, которая содержит еще и теоретические модели. Все
структуры этой базы имеют первичные структуры в белковой базе данных
NCBI
.
NDB
(Nucleic a
cids Data
B
ase) - база данных, которая содержит
пространственные структуры нуклеиновых кислот. В качестве основной части
базы выступает Atlas of Nucleic Acid Containing Structure, который содержит
структурированный каталог всех возможных структурных форм двойных
спиралей ДНК
, различных форм РНК
, графические изображения. Может
использоваться в качестве учебного пособия.
Информация в этих банках данных
хранится в виде файлов, содержащих
атомные координаты молекул, сведения о первичной и вторичной структуре,
данные ЯМР и кристаллографии, а так же библиографические ссылки [8]. Для визуализации собственно структуры молекул существует несколько
специальных программм: Cn3D, RasMol, Chime, Kinemage, которые требуют
установки на локальном компьютере.
Для образовательных целей лучше всего подходит программа Chime,
которая создана на основе RasMol и представляет собой plug-in, что позволяет
просматривать структуры молекул непосредственно в окне браузера.
Также при помощи Chime можно проигрывать скрипты (в данном случае
- это специальные программы для динамического представления данных),
написанные для RasMol [9].
1.5. Геномные базы данных
16
Генетическая изученность вида на современном уровне определяется
насыщенностью его геномной карты т.е. количеством генетических маркеров
(генов и анонимных нуклеотидных последовательностей
), чье положение
(локализация) определено в хромосоме или районе хромосомы.
Геномы картируют по разным причинам. Геном человека - для контроля
над генетическими заболеваниями, сельскохозяйственных животных - для
генетического улучшения пород, остальные с преимущественно научными
целями: изучения механизмов наследования признаков и выяснения
эволюционных взаимоотношений. По мере картирования генов у позвоночных (особенно млекопитающих)
стало ясно, что гены, одинаковые по эволюционному происхождению и
выполняемой функции (гомологичные) часто оказываются сцепленными с
одними и теми же гомологичными генами у разных видов. На основании этого
предсказывают вероятный район локализации генов у одних видов, если
известно, с какими генами они сцеплены у других, т.е. проводят
"сравнительное картирование". Конечно, подобная информация требует
подтверждения методами физического (локализация последовательности ДНК
)
или генетического картирования [3].
Геномные базы данных
создаются для быстрого поиска информации о
локализованных генетических маркерах у конкретного вида и гомологичных
генов у других. Кроме того, геномные базы данных призваны отображать
общую картину изученности геномов картируемых видов, включая
информацию о мутантных фенотипах, которая необходима для генетического
картирования.
Геномные базы данных
являются, как правило, частными инициативами
и большинство из них обновляется очень не регулярно. Это не существенно,
если геном, который они представляют, картируется не интенсивно. В
противном случае исследователь рискует столкнуться с устаревшей, не
отражающей истинное положение вещей, информацией. Так что, в первую
очередь (особенно для интенсивно картируеммых геномов), необходимо
17
убедиться в частой обновляемости базы данных. Как правило, такая
информация помещается на главной странице (нome page).
На данный момент существует геномные базы данных
ряда видов.
Некоторые из них построены однотипно, но есть и значительно отличающиеся
по своей структуре геномные базы данных. В настоящее время создатели
геномных баз данных стремятся выработать единый тип интерфейса,
максимально удобный для пользователя. Это уже привело к созданию
семейств ARKbd баз данных сельскохозяйственных животных и разработке
ACEDB genome database software с использованием которого создано
большинство геномных баз растений, прокариот и червей [5].
Для многих картируеммых видов не создано видоспецифических
геномных баз данных
. Чтобы получить информацию о геномах
этих видов,
рекомендуется использовать следующие базы данных.
OMIA
(
Online
Mendelian
Inheritance
In
Animals
) - база данных генов и
фенов наследственных болезней животных, для которых не существует
обширных баз данных
(т.е. всех, кроме человека, крысы и мыши). OMIA
создана в 1980 году и содержит ссылки на публикации, касающиеся всех
особенностей и болезней, которые являются семейными и связаны с
наследственностью. Она не содержит последовательностей. Немного
усложненная форма поиска, однако, оправданная сложностью задачи
нахождения гомологичных признаков у разных видов.
MGD homology query
содержит информацию о локализации
гомологичных генов у мышей, человека и более чем 70 видов млекопитающих,
при этом большая часть информации получена из опубликованной научной
литературы.
Entrez Genome Query
обеспечивает доступ к полным сиквенированным
геномам
(более 800; >500 вирусов, >25 бактерий, Saccharomyces cerevisiae,
Drosophila melanogaster; включает незаконченные геномы: human, mouse,
Caenorhabditis elegans, Plasmodium falciparum, Leishmania major, rice, and corn).
18
Здесь можно найти графическое представление полных геномов организмов, а
также интегрированные хромосомные карты дрозофилы и человека.
Comparative Mapping
(La Trobe University) - содержит отчеты комитета
по сравнительному картированию и интерфейс с диаграммами хромосом
человека с указанием гомологичных генов для других картируеммых видов.
Возможен переход к существующим видоспецифическим базам данных
[7].
1.6. Тематические банки и базы данных
Как оговаривалось выше, кроме таких основополагающих систем как
библиографические базы данных
и банки и базы данных нуклеотидных и
аминокислотных последовательностей
, существует большое количество более
специализированных массивов информации биологического характера,
доступных в Интернет. Сюда можно отнести, например, базу данных по
последовательностям 18S рРНК
или по рестриктазам, базу данных праймеров
для PCR или базу данных метаболических путей и т.д. [10].
1.7. Применение известных методов компьютерного анализа биологических данных
Существует широкий спектр методов и инструментов для
компьютерного анализа биологических данных. Здесь можно упомянуть и
BLAST
— наиболее популярный сервис для поиска похожих
последовательностей в базах данных
, и программы множественного
выравнивания аминокислотных последовательностей
, и программы
предсказания вторичных структур РНК
, программы визуализации
пространственных структур, программы моделирования динамики
пространственных структур и многое другое. Большинство этих программ
представлены в Интернете и имеют весьма удобный пользовательский
интерфейс. Любой компьютерный анализ биологических данных является
экспериментом и к нему предъявляются те же требования – важна четкость
постановки и необходимы соответствующие контроли. Значительная часть
биоинформатических работ сделана именно с применением уже
существующих средств. Для проведения такого рода работ, как правило, нет
19
необходимости уметь программировать. Достаточно только внимательно
анализировать результаты работы уже готовых программ. При этом часто
биоинформатический анализ предшествует постановке эксперимента [6].
Сравнение последовательностей (выравнивание) является важнейшей
задачей биоинформатики
. Трудно найти современного биолога, ни разу не
использовавшего пакет программ BLAST
и программу ClustalX
.
BLAST
(Basic Local Alignment Search Tool) - поисковый механизм
(программа) логического сравнения аминокислотных и нуклеотидных
последовательностей
. Данный поисковый механизм позволяет находить
одинаковые (подобные) области при сравнении последовательностей.
Программа проводит сравнение для нуклеотидной или белковой
последовательности, введенной пользователем, со всеми нуклеотидными или
протеиновыми последовательностями, имеющимися в базах данных
,
представленных на сайте NCBI
, и затем, подсчитывает в процентах статистику
совпадения общих участков для каждой пары сравниваемых
последовательностей.
BLAST
может быть полезен для оценки функциональных особенностей
последовательностей, для установки родственных связей между ними,
например, в качестве более поздних модификаций или для идентификации
членов генного семейства.
В настоящее время реализована версия Gapped
QBLAST
(2.0).
Эта
версия:
·
разрешает пробелы при сравнении последовательностей (так что
результат не разбивается на несколько последовательностей);
·
позволяет выполнять поиск по специфическим организма;
·
реализует PSI-BLAST
(Position-
S
pecific-
I
terated search), при
котором статистически значимые выравнивания преобразуются во
множественное выравнивание всех белков
. По этому выравниванию
генерируется матрица, которая может быть использована для следующих
итераций.
20
ClustalX
- программа для множественного выравнивания
последовательностей ДНК
и белков
. Работает в два этапа. Первый - попарное
выравнивание всех со всеми для оценки сходства. Второй этап - после
построения филогенетического дерева выравнивание глобальное. Программа
ClustalX написана с использованием кроссплатформенной библиотеки Vibrant
(NCBI
), поэтому ее версии существуют для всех основных операционных
систем - MacOS, различных вариантов Unix и Windows, причем интерфейс
программы практически идентичен на всех платформах. Минимально
достаточная для понимания работы программы информация находится
непосредственно в ее "Help" меню, а более полная документация - на
многочисленных интернет-сайтах, например
http://www.bioinf.org/molsys/ClustalX.html
.
Полезным свойством программы
является способность статистически оценить качество профиля в каждой
позиции и выделить области с низким качеством совмещения
последовательностей [8].
Глава 2. Опыт реализации ИТ в своей предметной области
2.1. Дизайн праймеров
для ПЦР
Метод ПЦРразработал К. Мюллис в 1985 году. Основными
компонентами ПЦР
, в ходе которой амплифицируется определенный
интересующий исследователя участок молекулы ДНК
, являются, во-первых,
сама исходная ДНК;
во-вторых, избыточное количество специально
подобранной пары олигонуклеотидных праймеров
, ограничивающих
выбранный участок ДНК; в-третьих, фермент термостабильная ДНК
полимераза и, в-четвертых, «строительный материал» в виде смеси
дезоксинуклеотидтрифосфатов. Цепной же данная реакция названа потому,
что продукты, наработанные ДНК-полимеразой в ходе предыдущего цикла
синтеза, используются в последующих.
Успех ПЦР
зависит в первую очередь от правильного выбора праймеров
.
Хорошо подобранные праймеры обеспечат высокий выход желаемого
21
продукта, тогда как ошибка при дизайне праймеров может привести к
неспецифической амплификации или вообще “убить” реакцию. Основными
моментами, которые следует учитывать при дизайне праймеров, являются
следующие:
·
Полимеразная реакция заключается в элонгации свободного 3’
конца затравки. Следовательно, основное внимание при дизайне праймера
следует уделять именно его 3’ концу. В целом праймер вовсе не должен быть
стопроцентно комплементарен амплифицируемой ДНК
- праймеры с
умеренным количеством некомплементарных матрице оснований вполне
могут работать в ПЦР
, что позволяет, например, зная последовательность ДНК
из одного организма, успешно амплифицировать гомологичный ген из
представителя близкородственного вида, даже если гомология этих генов и не
стопроцентная. Однако при амплификации неизвестных последовательностей
нужно обеспечить комплементарность матрице как минимум 3-5, а еще лучше
8, нуклеотидов с 3’ конца праймера.
·
Праймер не должен содержать самокомплементарных
последовательностей, склонных к образованию стабильных вторичных
структур - образование таких структур может препятствовать отжигу праймера
с матрицей.
·
Праймеры не должны образовывать гомо- или гетеродимеры.
Образование димеров возможно, если несколько оснований на 3’-концах
праймеров
комплементарны, особенно если образуется несколько ГЦ-пар,
причем комплементарными могут оказаться 3’-концы как разных, так и
одинаковых праймеров [4].
С учетом всех вышеизложенных пунктов передо мной стояла задача
написать праймеры
для синтеза гена антибактериального белка эскулентина
.
Данный белок является частью природного иммунитета амфибий, в частности,
представителей отряда Бесхвостые. Из зарубежных литературных источников
мною были получены данные по изучению активности эскулентина, которые
дали основание предполагать его использование для создания ветеринарных
22
препаратов антибактериального действия. Для получения белка необходимо
сначала синтезировать ген, встроить его в плазмиду бактерии и получить
экспрессию гена.
Для этого на сайте http://www.ncbi.nlm.nih.gov/
в базе данныхпервичных
последовательностей ДНК
и РНК
была найдена нуклеотидная
последовательность (матричная РНК) гена эскулентина
, изображенная на
рисунке 1 (выделена подчеркиванием).
FEATURES Location/Qualifiers
source 1..384
/organism="Rana esculenta"
/mol_type="mRNA"
/db_xref="taxon:8401"
/clone_lib="skin"
CDS 54..308
/codon_start=1
/product="esculentin 1b precursor"
/protein_id="CAA54844.1"
/db_xref="GI:1405799"
/db_xref="GOA:P40844"
/db_xref="InterPro:IPR004275"
/db_xref="InterPro:IPR012521"
/db_xref="UniProtKB/Swiss-Prot:P40844"
/translation="MFTLKKPLLLIVLLGMISLSLCEQERNADEEEGSEIKRGIF
-
SKLAGKKLKNLLISGLKNVGKEVGMDVVRTGIDIAGCKIKGEC"
sig_peptide 54..119
mat_peptide 168..305
/product="esculentin 1b"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
23
1 aaagtcttcc agctgtctac attctcagca ccaactgaac cacccgccca aagatgttca
61 ccttgaagaa acccctgtta ctgattgtcc ttcttgggat gatctcctta tctctctgtg
121 agcaagagag aaatgccgat gaagaagagg gaagcgaaat aaaaagagga attttctcca
181 aattggccgg gaaaaagctt aaaaatttgc tcataagcgg actcaagaat gtaggcaagg
241 aagttggcat ggacgtggtc agaactggca tagacattgc aggttgtaaa attaaaggtg
301 aatgttaaaa cctgaaatgg aagccatcta aagtggaata tcatttagca aaatgctaaa
361 tgtctaataa aaaatagtaa tatc
Рис
.1. Матричная
РНК
гена
эскулентина
. Из
приведенной
выше
информации
можно
узнать
, что
искомая
активная
часть
всей
молекулы
белка
(esculentin 1b) кодируется
последовательностью
нуклеотидов
в
позиции
168-305:
agga attttctcca aattggccgg gaaaaagctt aaaaatttgc
tcataagcgg actcaagaat gtaggcaagg aagttggcat ggacgtggtc agaactggca tagacattgc aggt
-
tgtaaa attaaaggtg aatg.
Согласно этой последовательности в соответствии с правилами были
написаны праймеры
F
1, R
1, F
2, R
2, представленные на рисунке 2.
F
1 ccgtccttaaaagaggtttaaccggccctttttcgaaccg
R
1 cgcctacattcttgagtccgcttatgagcaaatttttcgt
F
2 gggcgttccttcaaccgtacctgcaccactcttgaccgtcga
R
2 caccatcacctttaattttacaacctgcaatgtctaggc
Рис. 2. Праймеры для синтеза гена эскулентина
.
Затем, эти праймеры
были проанализированы на сайте
http://www.idtdna.com
/ на способность образовывать димеры. Анализ дал
отрицательный результат. Кроме того была определена оптимальная
температура для отжига праймеров.
В ПЦР
сначала использовались праймеры
F
1 и R
1, для синтеза одного
участка гена, затем F
2 и R
2 для синтеза другого участка, затем F
1 и R
2 для
синтеза целого гена.
Заключение
Информатика, в отличие от биологии, существует лишь около 50 лет.
Однако с момента своего возникновения она оказывала радикальное и все
24
более возрастающее влияние на все области знаний, включая биологию.
Анализируя историю развития науки, можно сделать вывод, что подавляющее
большинство революционных достижений биологии последних десятилетий
было бы невозможно без использования информационных технологий
.
В настоящее время определены полные или почти полные
последовательности геномов многих организмов. Прочтение полной
нуклеотидной последовательности
какого-либо генома не является самоцелью.
На самом деле это является первым шагом для исследования того, как
функционирует та или иная клетка. Исследование геномов бактерий
проводится для того, чтобы исследовать метаболизм бактерий и, в случае
патогенных организмов, найти потенциальные мишени для лекарств. С другой
стороны, изучение геномов может позволить найти новые метаболические
пути или ферменты, которые будут применены в биотехнологическом
производстве (например, витаминов). В течение как минимум полувека сотни
лабораторий исследовали кишечную палочку (
E
scherichia
coli
). Но даже такой
весьма изученный организм имеет как минимум 25% абсолютно не
охарактеризованных генов. Значительное число секвенированных геномов
принадлежат организмам, о которых вообще нет каких-либо других
экспериментальных данных. Экспериментальное определение функции только
одного гена требует интенсивной работы одной лаборатории как минимум в
течение нескольких месяцев. Компьютерный же анализ позволяет с известной
степенью точности охарактеризовать несколько тысяч генов силами
небольшой группы примерно за неделю. Разумеется, такой анализ не
исключает экспериментальную проверку, однако в этом случае работа
существенно упрощается.
Суммарные же объемы полученных первичных экспериментальных
данных только по молекулярно-генетическому уровню организации жизни
превышают сотни терробайт. В результате автоматической расшифровки
нуклеотидных последовательностей
в молекулярной биологии и генетике за
последние 20 лет произошел информационный взрыв: опубликованы полные
25
последовательности геномов 74 организмов включая 11 архебактерий, 48
эубактерий, 15 эукариот. На подходе 212 геномов прокариот и 157 эукариот.
Общее число нуклеотидов в секвенированных последовательностях превысило
1010. Кроме того, расшифрованы аминокислотные последовательности
миллионов белков
и более 15 тысяч пространственных структур белков [1].
Разработка эффективных технологий теоретического анализа и
компьютерного моделирования генетических систем и процессов обеспечивает
прорыв в области управления функциями геномов, селекции, в создании
трансгенных животных и растений, медицине, фармакологии, агробиологии,
биотехнологии, генотерапии, генодиагностике, и других высоких технологиях.
Именно с их развитием связаны надежды на решение множества проблем,
критических для устойчивого развития человечества в XXI
веке.
Список литературы к реферату
1.
Гельфанд М. С. Компьютерный анализ последовательностей ДНК
/
М. С. Гельфанд // Молекулярная биология – 1998. – т. 32. – №1. – C. 103-120.
2.
Гельфанд М. С. Биоинформатика: от эксперимента к
компьютерному анализу и снова к эксперименту / М. С. Гельфанд, В. А.
Любецкий // Вестник Российской академии наук. – 2003. – том 73. – № 11. – C.
987-994.
3.
Компьютерный анализ генетических текстов / Ред. М.Д.Франк-
Каменецкий – Москва: Наука, 1990. – 393 с.
4.
Маниатис Т., Фрич Э., Сэмбрук Дж. Методы генетической
инженерии. Молкулярное клонирование. – М.: Мир, 1984. – 480 с.
5.
Bioinformatics and Functional Genomics Jonathan Pevsner [Electronic
r
esource] / Mode of access: http://www.bioinfbook.org/ – Date of access:
14.11.2006.
6.
http://www.fbb.msu.ru/
7.
http://www.jcbi.ru/
8.
http://molbiol.edu.ru/
9.
http://www.ncbi.nlm.nih.gov/
26
10.
http://
www.nsu.ru/
11.
http://
www.vak.org.by/
Предметный указатель к реферату
B
BioMedNet
.....................................................
9, 11, 29, 32
BIOSIS
...........................................................................
10
BLAST
...............................................................
19, 20, 31
C
Chemical Abstracts
...................................................
10, 11
ClustalX
....................................................................
20, 21
Comparative Mapping
....................................................
19
D
DDBJ
................................................................
7, 9, 12, 13
E
EMBL
.............................................
7, 9, 12, 13, 14, 15, 45
Entrez Genome Query
....................................................
18
Entrez retrieval system
.....................................................
8
G
GenBank
.....................................................
7, 9, 12, 14, 15
H
HealthGate
..................................................................
9, 11
M
MEDLINE
............................................
8, 9, 10, 11, 29, 32
MGD homology query
...................................................
18
MMDB
.......................................................................
9, 16
N
NCBI
.........................................
8, 9, 12, 16, 20, 21, 31, 32
NDB
................................................................................
16
Network Entrez
.................................................................
9
O
OMIA
.......................................................................
18, 45
P
PDB
................................................................
9, 14, 15, 16
PIR
..........................................................................
7, 9, 14
PRF/SEQDB
...................................................................
15
PubMed
...........................................................
9, 11, 15, 32
S
SRS
.......................................................................
9, 15, 45
SWISS-PROT
.............................................
7, 9, 14, 15, 45
T
TREMBL
..................................................................
14, 15
А
Аминокислотная последовательность
.....
4, 7, 9, 14, 19,
26, 31, 45
Б
База данных
....
4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 31, 32
б
базы данных
..................................................................
32
Б
Банк данных
..............................................
6, 9, 12, 13, 16
Белки
................
4, 5, 7, 8, 9, 11, 12, 15, 16, 20, 21, 26, 31
Биоинформатика
...................................................
4, 7, 20
Г
Геном
.............................................................................
18
Геномика
.........................................................................
5
Д
ДНК
4, 5, 7, 8, 9, 11, 12, 13, 15, 16, 17, 21, 22, 23, 26, 31
И
Интерфейс
...........................................................
8, 11, 15
Информационные технологии
.........................
1, 4, 6, 25
к
кДНК
............................................................................
4, 7
Н
Нуклеотидная последовательность
..
5, 7, 12, 13, 14, 15,
17, 20, 25, 31
П
Полимеразная цепная пеакция
....................
4, 21, 22, 24
Праймер
.......................................................
19, 21, 22, 24
Р
РНК
..............................
4, 5, 6, 7, 8, 11, 12, 13, 16, 19, 23
27
р
рРНК
..............................................................................
19
С
Секвенирование
..............................................................
5
Э
Эскулентин
........................................................
22, 23, 24
28
ИНТЕРНЕТ РЕСУРСЫ В ПРЕДМЕТНОЙ ОБЛАСТИ ИССЛЕДОВАНИЯ
http://www.bmn.com
/
BioMedNet
организован
Elsevier Science. Это web-сайт для биологов и
медицинских работников. Можно получать новости сайта по E-mail. На этом
сайте:
публикуются обзоры, новости, обзоры конференций;
имеется хорошая подборка аннотированных web-ресурсов;
имеется список журналов со свободным доступом (часто временно
ради рекламы доступны хорошие журналы), возможность подписаться на
"содержание журналов";
возможен поиск фирм производителей конкретной медико-
биологической продукции;
имеются: MEDLINE
; Technical Tips (коллекция молекулярно-
биологических протоколов);
имеется база вакансий с возможностью поиска.
http://www.delphion.com
/
IBM Patent Server. IBM Intellectual Property Network (IPN). Позволяет
искать и просматривать патентные документы. Обеспечивает доступ к:
United States patents (US). С 1971 г. и до настоящего времени.
Еженедельное обновление. Полный текст с картинками. От
U.S. Patent and
Trademark Office;
European patents - applications (EP-A). С 1979 г. и до настоящего
времени. Еженедельное обновление. Библиографический текст с картинками.
От European
Patent
Office
; Vienna
, Austria
;
European patents - issued (EP-B). С 1980 г. и до настоящего времени.
Еженедельное обновление. Библиографический текст с картинками. От
European
Patent
Office
; Vinna
, Austria
;
Pat
ent Abstracts of Japan (JP). С 1976 г. и до настоящего времени.
Еженедельное обновление. Библиографический текст, первая страница. От JA
-
PIO
, Japan
Patent
Information
Organization
; Toyko
, Japan
;
IBM
Technical
Disclosure
Bulletins
.
Картинки приходят в "*.pdf" формате, причём их качество обычно
довольно хорошее.
http://www.google.com
/
Всемирно известная поисковая система Google. Позволяет производить
простой поиск по ключевым словам, возможен вариант расширенного поиска
по группам (среди книг, музыкальных файлов или видеофайлов, новостей и
т.д.), особым признакам (определение, тип файла) и т.д. Поиск информации в
сети Интернет обычно начинается с этого сайта.
http
://
highwire
.
stanford
.
edu
/
Этот сайт секции библиотеки Стэнфордского университета предлагает
вниманию пользователей огромную базу материалов, которые можно
загрузить бесплатно в полном объеме. Источниками предлагаемых статей
являются 975 журналов. Читатели имеют возможность доступа к полным
текстам почти 1 435 924 статей, которые перед публикацией получили
рецензию экспертов. Возможен быстрый поиск и расширенный поиск (по
авторам статей, названиям, цитатам, ключевым словам и т.д.).
http
://
www
.
issep
.
rssi
.
ru
/
Биологическая секция Соросовского образовательного журнала (СОЖ).
Журнал выходит ежемесячно общим тиражом в 13 000 экземпляров и
распространяется бесплатно. Статьи СОЖ в формате pdf с хорошими
графиками и картинками написаны российскими профессорами доступным
популярным языком на хорошем современном научном уровне. Главный
редактор журнала - профессор молекулярной генетики Валерий Сойфер. На
мой взгляд, статьи могут быть интересны и специалистам, особенно если
статья касается смежной области, о которой нужно получить первое
представление. В разделе биология более 300 статей.
http://molbiol.edu.ru
/
Практическая молекулярная биология
. Сайт является незаменимым для
биохимиков, генетиков, микробиологов и молекулярных биологов. Это
крупнейшая биологическая база данных. Сайт содержит подробный
справочник, который состоит из наиболее важных разделов. Здесь можно
найти руководства и рекомендации по выполнению тех или иных операций,
подробное описание методов исследования (работа с бактериями,
бактериофагами, эукариотическими организмами, дигибридные системы,
методы выделения и анализа ДНК
про- и эукариотических организмов, работа
с белками
), методики и расчеты для приготовления растворов, подбор
необходимых для исследования ферментов и реактивов. Можно следить за
свежими публикациями. Имеются обзоры различных биологических ресурсов
и программ, а также ссылки на биологические журналы и гранты
биологического профиля. Внимание уделяется также образованию и
образовательным ресурсам. Имеются сведения о компаниях и р
усскоязычных
институтах биологического профиля, а также ссылки на полезные web-
ресурсы
.
http://nar.oxfordjournals.org
/
NAR database. Ежегодно первый номер журнала "
Nucleic Acid Research
"
посвящён обзору молекулярно-биологических баз данных
. Обзорную статью
этого номера и сортированные (по темам и по алфавиту) списки баз данных в
HTML формате можно найти на сайте журнала (кнопка "NAR database issue").
http://www.ncbi.nlm.nih.gov/
National Center for Biotechnology Information
(NCBI) организован
в
1988
году
как
отделение
National Library of Medicine (NLM) в
National Institutes of
Health (NIH). В настоящее время это крупнейшая биологическая база данных
(молекулярная биология, биохимия и генетика). NCBI имеет мощные системы
обработки и представления этих данных. Содержит следующие базы данных
и
программы для поиска: GenBankRefSeq
, DbSNP
, UniGene
, OMIM
, Genomic
Biology
, Entrez
, Entrez
Genomes
, BLAST
, программы BLAST
поиска, базы
данных для BLAST
поиска, базы аминокислотных последовательностей
, базы
нуклеотидных последовательностей
. Здесь можно найти руководства или
рекомендации по выполнению тех или иных операций, описание методов
исследования, растворов, расчетов, подбор рестриктаз для исследования.
Можно следить за свежими публикациями. Имеются обзоры и справочник.
Внимание уделяется также образованию и образовательным ресурсам. Книги
на сайте NCBI читать подряд неудобно, но зато есть возможность поиска.
PubMed
– это информационный ресурс NIH
, состоящий из множества
разделов. Он содержит более 16 миллионов цитат из научных журналов
биомедицинской и естественнонаучной направленности, начиная с 1950-х
годов. Здесь размещаются ссылки на полные тексты статей и другие связанные
ресурсы (на страницы Национальной Библиотеки медицины США; на
страницу MEDLINE
– базу материалов о более чем 700 заболеваниях, о
лекарственных средствах, на этом портале есть также медицинская
энциклопедия и медицинский словарь и много другой полезной информации;
на базы данных
по токсикологии и токсическим веществам и др.). Поиск в базе
данных журналов можно осуществлять по предмету или по названию журнала,
по сокращенному названию, аббревиатуре ISO
и другим параметрам. PubMed
содержит полное содержание MEDLINE и PREMEDLINE баз данных и
некоторые статьи не входящие в них. Очень удобно доверить регулярный
просмотр ссылок на PubMed программе BioMail
. Medline
на уже упоминавшемся "BioMedNet
". Medline
на
"HealthWord Online".
Medline
на
"Medscape Molecular Medicine".
Citat
ion Matcher организован
NCBI
и
NIH. Позволяет найти статью
по библиографическим данным. Возможен поиск сразу же большого
количества статей. Можно использовать Citation
Matcher
через E
-
mail
(
E
-
Mail
Citation
Matcher
). Для того чтобы узнать правила работы достаточно послать
письмо с текстом HELP.
http://www.sciencedirect.com
/
База данных и поисковая система, с
одержащая оглавления
научных
журналов издательства Elsevier по естественным наукам. Предлагает
вниманию пользователей материалы по научной, медицинской и технической
информации: более 2000 рецензируемых журналов, сотни книжных серий,
руководств и справочников. Поиск информации можно осуществлять по
ключевым словам. Возможен вариант расширенного поиска (по названию
журнала, статьи; поиск по автору, и др.). Для организаций, подписанных на
издания Elsevier, предоставлен полнотекстовый доступ к статьям, в других
случаях – доступ только к рефератам. Позволяет следить за текущей
литературой.
http
://
www
.
scirus
.
com
/
Scirus
– наиболее полная поисковая система для ученых в Интернете.
Основанный на последних поисковых технологиях, он ищет более, чем в 300
миллионах определенных для науки Web
-страницах, позволяя пользователям
быстро находить:
научные, медицинские и технические сведения;
последние публикации; рецензируемые журналы; патенты и
журналы, которые обычно пропускают другие поисковые системы;
поисковик предлагает уникальные функциональные возможности
для ученых и исследователей.
Эта поисковая система обращает внимание только на те Web
-страницы,
которые содержат научную информацию.
http
://
searchlauncher
.
bcm
.
tmc
.
edu
/
Search Launcher организован
Baylor College of Medicine. Сайт
предоставляет возможность проводить различные молекулярно-биологические
анализы или поиски со стандартного и очень простого интерфейса. На сервере
можно выполнять простые преобразования последовательностей. Есть
возможность организовать анализ многих последовательностей одновременно.
Ресурс просто незаменим для тех, кто не чувствует себя большим мастером по
анализу последовательностей.
http://www.vak.org.by
/
Сайт Высшей
аттестационной комиссии Республики Беларусь. На нем
размещены материалы, касающиеся подготовки научных кадров, присуждения
ученых степеней и званий, краткие паспорта специальностей и программы-
минимумы кандидатских экзаменов по специальности; в разделе «Каталог
файлов» представлены доступные для скачивания файлы нормативных
документов с приложениями и шаблоны регистрационных документов.
Организован поиск по сайту и в сети Интернет.
ДЕЙСТВУЮЩИЙ ЛИЧНЫЙ САЙТ В WWW
http
://
sovgirnet
.
narod
.
ru
/
ГРАФ (КРУГ) НАУЧНЫХ ИНТЕРЕСОВ
магистрантки Совгир Н.В. биологического факультета, специальность микробиология
Смежные специальности
Основная специальность
·
03.00.04 - биохимия
1.
Химический состав, строение и свойства веществ живой природы,
вопросы анализа, исследования свойств, выделение и способы
использования классов и групп соединений: б
елки, ферменты,
нуклеиновые кислоты
, у
глеводы и полисахариды, витамина и другие
низкомолекулярные биорегуляторы, липиды, г
ормоны, аминокислоты
и органические кислоты, пигменты, в
ещества фенольной природы
.
2.
Взаимопревращение веществ в живом объекте.
3.
Термодинамика и кинетика биохимических процессов.
4.
Биохимия фотосинтеза и других светозависимых процессов.
5.
Исследование молекулярных основ функционирования клетки и ее
органелл.
6.
Строение биологических мембран, их свойств и функции, мембранный
транспорт.
7.
Изучение процессов биоэнергетики и АТФ-цикла, гликолиза и цикла
трикарбоновых кислот, фосфоглюконатного пути, переноса электронов
и окислительного фосфорилирования.
8.
Фиксация азота.
9.
Сократительные системы и системы движения.
10.
Биохимия процессов репликации, транскрипции и
трансляции генетической информации.
11.
Молекулярные основы происхождения жизни,
эволюционная биохимия.
12.
Разработка биохимических методов исследования.
·
03.00.15 – генетика
1.
Цитогенетика, клеточная и хромосомная инженерия. 2.
Геносистематика. 3.
Генетика биологических систем in vitro. 4.
Генетика метаболизма. 5.
Генетика онтогенеза, эпигенетика. 6.
Мутагенез и антимутагенез. 7.
Нехромосомная наследственность. 8.
Генетика фитоиммунитета. 9.
Популяционная и эволюционная генетика. 10.
Генетика микроорганизмов. 11.
Экологическая генетика. 12.
Медицинская генетика. 13.
Математическая генетика. 14.
Генетические основы селекции растений. 15.
Генетические основы селекции животных. ·
03.00.16 – экология
1.
Изучение общих закономерностей функционирования биологических
систем. ·
03.00.07 –
микробиология
1.
Эволюция и
филогенетическое
положение
микроорганизмов. 2.
Выделение,
культивирование и
идентификация
микроорганизмов. 3.
Морфология,
физиология, биохимия и
генетика
микроорганизмов. 4.
Исследование
микроорганизмов на
популяционном уровне. 5.
Изучение
различных форм
взаимоотношений между
микроорганизмами
(сапро
фитизим, паразитизм,
симбиоз, антагонизм и
др.). 6.
Роль
микроорганизмов в
круговороте веществ.
7.
Обмен веществ
микроорганизмов.
8.
Использование
микроорганизмов и
продуктов их метаболизма
в различных областях
промышленности,
сельском хозяйстве и
охране окружающей
сре
ды.
2.
Исследование в природных и лабораторных условиях взаимодействия
биологических систем разного уровня организации между собой, а
также с факторами среды. 3.
Изучение реакций организма и его систем на действия
неблагоприятных и экстремальных факторов. 4.
Изучение общих законов взаимодействия человека и биосферы. 5.
Изучение генетических эффектов, вызванных экологическими
воздействиями. 6.
Изучение механизмов и закономерностей сезонной и многолетней
динамики изменения функционирования организмов. 7.
Изучение воздействия природных и антропогенных факторов на
параметры жизненных циклов организма. 8.
Изучение разнообразных типов межпопуляционных отношений. 9.
Исследование видового разнообразия сообществ в разнотипных
природно-климатических регионах. 10.
Изучение структуры и закономерностей
функционирования биогеоценозов в различных природно-
климатических регионах. 11.
Разработка и создание искусственных экосистем,
управления их функционированием. 12.
Разработка теоретических основ, моделей и методов
рационального и экологически безопасного природопользования, а
также экологически обоснованных норм воздействия человека на
живую природу. 13.
Разработка методов повышения приспособительных
возможностей организма и обеспечения нормального его
функционирования в измененных условиях среды. 14.
Изучение и разработка методов оценки ущерба,
причиненного природной среде в результате превышения
нормативных выбросов, сбросов, аварий на промышленных объектах и
стихийных бедствий. ·
03.00.23 – биотехнология
1.
Генетические, селекционные и иммунологические исследования,
изучение новых методов молекулярного клонирования генов для целей
производства.
2.
Разработка научно-методических основ
применения стандартных
биосистем на молекулярном, клеточном, тканевом и организменных
уровнях в научных исследованиях.
3.
Разработка технологических режимов выращивания микроорганизмов-
продуцентов,
культур
клеток растений
и животных для получения
биомассы и
ее компонентов.
4.
Исследование и разработка требований к сырью, включая вопросы его
предварительной обработки.
5.
Изучение и разработка процессов и аппаратов микробного синтеза
6.
Разработка новых биотехнологических процессов на основе
микробного синтеза, биотрансформации, биодеструкции,
биоокисления.
·
03.00.24 – микология
1.
Проблемы происхождения, эволюции грибов, филогенетических
связей между ними, классификации и номенклатуры. 2.
Флористические исследования грибов в разных эколого-
географических районах. 3.
Изучение морфологии, цитологии и ультраструктуры грибов, их
онтогенеза, морфогенеза, жизненных циклов и систем размножения. 4.
Исследование генетических, физиолого-биохимических механизмов в
грибных организмах. 5.
Исследование структуры грибных популяций и эколого-трофических
групп грибов. 6.
Изучение симбиотических связей грибов с растениями (лишайники,
микориза и др.). 7.
Изучение грибов-паразитов растений. Разработка биологических основ
борьбы с ними. 8.
Исследование возможностей и путей рационального использования
грибов (микологическое ресурсоведение). 9.
Исследование вопросов сохранения, воспроизводства грибных
ресурсов. 10.
Разработка биологических основ промышленного
культивирования высших базидиальных грибов.
ПРЕЗЕНТАЦИЯ МАГИСТЕРСКОЙ ДИССЕРТАЦИИ
Презентацию, выполненную в Power Point, можно посмотреть по
следующей ссылке:
http
://
sovgirnet
.
narod
.
ru
/
sovpresent
.
ppt
СПИСОК ЛИТЕРАТУРЫ К ВЫПУСКНОЙ РАБОТЕ
1.
Access
2000: справочник / Гюнтер Штайнер; науч. ред.
С.И.Молявко. – М.: Лаборатория Базовых Знаний, 2000. – 474 с.
2.
Access
2000: самоучитель / П.Ю.Дубнев. – М.: ДМК Пресс, 2004. –
313 с., ил.
3.
Excel
2000 / Марк Зайден; науч. ред. А.Плещ, С.Молявко. – М.:
Лаборатория Базовых Знаний, 1999. – 328 с., ил.
4.
Microsoft
Office
2000 / Стив Сагман; пер. с англ. А.И.Осипова,
П.А.Мерещук. – М.: ДМК, 2002. - 669 c
., ил.
5.
Microsoft
Office
XP
в целом: наиб. полное рук-во. Для широкого
круга пользователей / Ф.Новиков, А.Яценко. – Спб: БХВ-Петербург, 2002. –
917 с., ил.
6.
Microsoft
PowerPoint
2003: самоучитель / М.В.Спека. – Москва,
Санкт-Петербург, Киев: Диалектика, 2004. – 363 с., ил.
7.
Microsoft
Word
2003 в теории и на практике / С.Бондаренко,
М.Бондаренко. – Минск: Новое знание, 2004. – 336 с., ил.
8.
Windows
2000: проблемы и решения. Спец. справочник / Мэтью
Штребе; пер. с англ.П.Анджан, А.Войтенко. – Спб: Питер, 2002 – 858 с.
9.
Word
2000 / Марк Зайден; науч. ред. В.Гребнев, С.Молявко. – М.:
Лаборатория Базовых Знаний, 1999. – 336с., ил.
10.
Шафрин Ю.А. Информационные технологии: учеб. пособие: В 2 ч /
Ю.А.Шафрин. – М.: Лаборатория Базовых Знаний, 2003. – Ч.1: Основы
информатики и ИТ – 316 с., ил.
11.
Шафрин Ю.А. Информационные технологии: учеб. пособие: В 2 ч /
Ю.А.Шафрин. – М.: Лаборатория Базовых Знаний, 2003. – Ч.1: Офисная
технология и ИТ – 336 с., ил.
12.
Ваш Office
2000: MS
Word
, MS
Excel
, Internet
Explorer
и др. /
С.Баричев, О.Плотников. – М.: КУДИЦ ОБРАЗ, 2000. – 318 с., ил.
13.
Информатика: учеб. для студ. вузов, обуч. по естеств.-науч. напр. и
спец. / В.А.Каймин. – М.: ИНФРА-М, 2000. – 232 с., ил.
14.
Компьютерные презентации: от риторики до слайд-шоу /
Т.М.Елизаветина. – М.: КУДИЦ ОБРАЗ, 2003. – 234 с.
15.
Освой самостоятельно Microsoft
Excel
2000 = Teach
Yourself
Mi
-
crosoft
Excel
2000: 10 минут на урок: учеб. пособие: пер. с англ. / Дженнифер
Фултон – М.: Издательский дом «Вильямс», 2000. – 224 с., ил.
16.
Технологии работы с текстами и электронными таблицами: Word
,
Excel
/ М.С.Шибут; под ред. И.Ф.Богдановой. Минск: общественное
объединение «Молодежное научное общество», 2000. – 142 с.
ПРИЛОЖЕНИЕ A
Презентация магистерской диссертации
1
Белорусский
государственный
университет
Биологический
факультет
Кафедра
микробиологии
Система
клонирования
белков
, обладающих
антимикробной
активностью
Магистерская
диссертация
Совгир
Натальи
Владимировны
Научный
руководитель
д
.
б
.
н
., профессор
Прокулевич
Владимир
Антонович
Минск
2009
2
Антимикробные
пептиды
(
antimicrobial peptibes
) -
очень
короткие
белковые
молекулы
, состоящие
примерно
из
20
-
50
аминокислот
, которые
вырабатываются
клетками
животных
и
человека
для
борьбы
с
микробами
3
Антимикробные
пептиды
-
часть
системы
врожденного
иммунитета
животных
. В
отличие
от
антител
, они
не
модифицируются
в
течение
жизни
организма
и
не
"
подстраиваются
" под
новые
виды
возбудителей
Самым
богатым
"
месторождением
" таких
пептидов
является
кожа
амфибий
, в
частности
лягушек
и
жаб
4
Актуальность
выбранного
направления
работы
В
последнее
время
актуальна
проблема
устойчивости
штаммов
бактерий
к
традиционным
методам
терапии
, связанных
с
использованием
широкого
спектра
антибиотических
веществ
. Бактерии
приспосабливаются
к
любым
видам
антибиотиков
, что
сводит
на
нет
все
усилия
по
борьбе
с
инфекцией
, и
может
привести
к
полному
отказу
от
антибиотического
воздействия
на
возбудителей
инфекционных
заболеваний
Кроме
того
, участились
случаи
заболевания
сельскохозяйственных
животных
эндометритами
и
маститами
, имеющими
бактериальную
этиологию
. Лечение
животных
по
указу
ветуправления
с
использованием
антибиотиков
проводить
нежелательно
, в
связи
с
чем
необходимо
осуществлять
поиск
новых
препаратов
5
Согласно
литературным
данным
, к
настоящему
времени
наиболее
изучены
пять
антимикробных
пептидов
(
temporin A
, B
и
G
, esculentin
1
b
и
bombinin H
2), выделенных
из
кожи
трех
различных
видов
лягушек
и
жаб
(
Rana temporaria
, Rana esculenta
и
Bombina variegata
). Все
пептиды
являются
эффективными
антибактериальными
агентами
:
temporin
A, B и
G более
эффективны
против
грамположительных
бактерий
и
действуют
при
С
= от
0,5 до
48 µ
М
esculentin
1b проявляет
активность
через
2
-
20 минуты
в
основном
против
грамотрицательных
микроорганизмов
при
С
= от
0,5 до
32 µ
М
bombinin
H2 аналогично
действует
на
все
виды
штаммов
бактерий
при
С
= от
4 до
16 µ
М
6
Объект
изучения
В
качестве
объекта
изучения
выступает
белок
эскулентин
который
, согласно
проведенным
исследованиям
, активно
убивает
лекарственно
-
устойчивые
штаммы
грамположительных
бактерий
(
Staphylococcus aureus
, Enterococcus faecium
) в
средних
и
низких
концентрациях
, и
в
более
низких
концентрациях
,
грамотрицательные
штаммы
(
Stenotrophomonas maltophilia
, Acinetobacter baumanii
, Pseudomonas
aeruginosa
). Активность
молекулы
эскулентина
семейства
1
b
обусловлена
N
-
концевой
областью
(1
-
18)
Из
5 вышеупомянутых
антибактериальных
белков
эскулентин
характеризуется
наибольшей
длинной
пептидной
цепи
(138 аминокислот
) и
наличием
небольшого
числа
триплетов
, кодирующих
не
характерны
е
для
бактерии
E
. coli
аминокислоты
7
Целью
работы
является
разработка
системы
клонирования
белков
, обладающих
антимикробной
активностью
, с
использованием
плазмиды
pET
-
24
a на
основе
штамма
E
. coli
XL
-
1
blue
8
Задачами
работы
являются
:
1
.
Клонирование
гена
антимикробного
белка
эскулентина
2
. Оптимизация
условий
экспрессии
для
получения
максимального
выхода
целевого
продукта
3
. Очистка
белкового
продукта
и
оценка
возможности
его
использования
в
качестве
препарата
для
лечения
эндометритов
и
маститов
сельскохозяйственных
животных
9
Этапы
проведения
работы
На
первом
этапе
был
синтезирован
ген
эскулентина
с
использованием
праймеров
F1
,
R1
,
F2 и
R2
. Данные
праймеры
были
сконструированы
на
основе
имеющихся
в
базе
данных
GenBank
Национального
центра
биотехнологической
информации
последовательностей
(
последовательность
168
-
305 выделена
зеленым
цветом
)
ORIGIN
1 aaagtcttcc agctgtctac attctcagca ccaactgaac cacccgccca aagatgttca
61 ccttgaagaa acccctgtta ctgattgtcc ttcttgggat gatctcctta tctctctgtg
121 agcaagagag aaatgccgat gaagaagagg gaagcgaaat aaaaag
agga
attttctcca
181 aattggccgg
gaaaaagctt
aaaaatttgc tcataagcgg actcaagaat gtaggcaagg
241 aagttggcat ggacgtggtc agaactggca tagacattgc aggttgtaaa attaaaggtg
301 aatg
ttaaaa cctgaaatgg aagccatcta aagtggaata tcatttagca aaatgctaaa
361 tgtctaataa aaaatagtaa tatc
10
Характеристика
праймеров
F1
,
R1
,
F2 и
R2
Праймер
Нуклеотидная
последовательность
5'
-
3' F1
5
’
ccgtccttaaaagaggtttaaccggccctttttcgaaccg
3
’
R1
5
’
cgcctacattcttgagtccgcttatgagcaaatttttcgt
3
’
F2
5
’
gggcgttccttcaaccgtacctgcaccactcttgaccgtcga 3
’
R2
5
’
caccatcacctttaattttacaacctgcaatgtctaggc
3
’
11
На
следующем
этапе
синтезированный
ген
эскулентина
был
использован
в
качестве
матрицы
для
амплификации
с
помощью
полимеразной
цепной
реакции
. Размер
ожидаемого
продукта
равен
150 н
.
п
.
Рис
. 1. Результаты
амплификации
гена
эскулентина
с
использованием
праймеров
F1
,
R1
,
F2 и
R2
Дорожка
1
–
продукт
амплификации
при
температуре
отжига
60
°С
Дорожка
2
–
маркер
молекулярного
веса
Fermentas SM0333
1 2
Продукт
амплификации
затем
был
подвергнут
рестрикции
с
использованием
рестриктаз
NdeI
(
сайт
рестрикции
CATATG
)
и
XhoI (
сайт
рестрикции
AAGCTT
)
12
Затем
ген
эскулентина
был
клонирован
в
вектор
экспрессии
pET
-
24a
(+), которым
был
трансформирован
штамм
Escherichia coli XL
-
1Blue
Рис
. 2. Карта
вектора
экспрессии
pET
-
24a(
+):
T7
промотор
311
-
327
Полилинкер
(
BamH
1
–
Xho
1) 158
-
203
Последовательность
, кодирующая
His
-
Tag 140
-
157
T7 терминатор
26
-
72
Последовательность
, кодирующая
lac1 714
-
1793
Последовательность
, отвечающая
за
устойчивость
к
Kam
3936
-
4748
13
После
индукции
ИПТГ
был
получен
белковый
продукт
, который
по
размеру
соответствовал
белку
эскулентину
(
около
19 кДа
)
Рис
. 3. Электрофорез
суммарных
клеточных
белков
штамма
Escherichia coli XL
-
1Blue
(
pET
-
24b
(+)+
Esc
)
Дорожка
1
–
белки
-
стандарта
молекулярных
масс
(
сверху
вниз
: 116 кДа
,
66
кДа
, 45 кДа
, 35 кДа
, 25 кДа
, 18,4 кДа
,
14,4 кДа
)
Дорожка
2
–
через
4 ч
. после
индукции
ИПТГ
в
концентрации
0,4 мМоль
/
л
Дорожка
3 –
без
индукции
ИПТГ
1 2 3
19 кДа
14
С
использованием
сконструированных
праймеров
синтезирован
и
амплифицирован
ген
антимикробного
белка
эскулентина
Продукт
амплификации
клонирован
в
вектор
экспрессии
Полученный
белковый
продукт
полностью
соответствует
белку
эскулентину
Выводы
15
Спасибо
за
внимание
!
Exit
Тестовые вопросы по курсу «Основы информационных технологий»
1. Свойство font-variant CSS описывает:
а)
варианты отображения шрифта
б)
варианты степени жирности элемента
в)
варианты стилей элемента
г)
варианты размера шрифта
<
question
type
="
close
" id
="102">
<text> (Совгир Наталья Владимировна) Свойство font-variant CSS
описывает:</text>
<answers type="request">
<answer id="1" right="1">
варианты
отображения
шрифта
</answer>
<answer id="2" right="0">варианты степени жирности элемента </answer>
<answer id="3" right="0">варианты стилей элемента </answer>
<answer id="4" right="0">
варианты
размера
шрифта
</answer>
</answers>
</question>
2. Базой данных, содержащей информацию об аминокислотных
последовательностях
, является:
а
) EMBL
б
) SWISS-PROT
в
) OMIA
г
)
SRS
<
question type="close" id="602">
<text> (Совгир Наталья Владимировна) Базой данных, содержащей
информацию об аминокислотных последовательностях
, является:</text>
<answers type="request">
<answer id="1" right="0">EMBL
</answer>
<answer id="2" right="1">SWISS-PROT
</answer>
<answer id="3" right="0">OMIA
</answer>
<answer id="4" right="0">SRS
</answer>
</answers>
</question>
Автор
dostelon
Документ
Категория
Без категории
Просмотров
607
Размер файла
4 750 Кб
Теги
рефераты, совгир
1/--страниц
Пожаловаться на содержимое документа