close

Вход

Забыли?

вход по аккаунту

?

1016.Вестник Томского государственного университета. Биология №4 2011

код для вставкиСкачать
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
МИНИСТЕРСТВО ОБРАЗОВАНИЯ И НАУКИ РОССИЙСКОЙ ФЕДЕРАЦИИ
ВЕСТНИК
ТОМСКОГО
ГОСУДАРСТВЕННОГО
УНИВЕРСИТЕТА
БИОЛОГИЯ
Tomsk State University Journal of Biology
Научный журнал
2011
№ 4 (16)
Свидетельство о регистрации: ПИ № ФС 77-29499
от 27 сентября 2007 г.
Журнал «Вестник Томского государственного университета. Биология»
входит в «Перечень ведущих рецензируемых научных журналов
и изданий, в которых должны быть опубликованы
основные научные результаты диссертаций
на соискание ученых степеней доктора и кандидата наук»
Высшей аттестационной комиссии
ТОМСКИЙ ГОСУДАРСТВЕННЫЙ УНИВЕРСИТЕТ
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
НАУЧНО-РЕДАКЦИОННЫЙ СОВЕТ
ТОМСКОГО ГОСУДАРСТВЕННОГО УНИВЕРСИТЕТА
Майер Г.В., д-р физ.-мат. наук, проф. (председатель); Дунаевский Г.Е., д-р
техн. наук, проф. (зам. председателя); Ревушкин А.С., д-р биол. наук, проф.
(зам. председателя); Катунин Д.А., канд. филол. наук, доц. (отв. секр.); Аванесов
С.С., д-р филос. наук, проф.; Берцун В.Н., канд. физ.-мат. наук, доц.; Гага В.А.,
д-р экон. наук, проф.; Галажинский Э.В., д-р психол. наук, проф.; Глазунов
А.А., д-р техн. наук, проф.; Голиков В.И., канд. ист. наук, доц.; Горцев А.М.,
д-р техн. наук, проф.; Гураль С.К., канд. филол. наук, проф.; Демешкина Т.А.,
д-р филол. наук, проф.; Демин В.В., канд. физ.-мат. наук, доц.; Ершов Ю.М.,
канд. филол. наук, доц.; Зиновьев В.П., д-р ист. наук, проф.; Канов В.И., д-р
экон. наук, проф.; Кривова Н.А., д-р биол. наук, проф.; Кузнецов В.М., канд.
физ.-мат. наук, доц.; Кулижский С.П., д-р биол. наук, проф.; Парначев В.П.,
д-р геол.-минер. наук, проф.; Петров Ю.В., д-р филос. наук, проф.; Портнова Т.С., канд. физ.-мат. наук, доц., директор Издательства научно-технической
литературы; Потекаев А.И., д-р физ.-мат. наук, проф.; Прозументов Л.М., д-р
юрид. наук, проф.; Прозументова Г.Н., д-р пед. наук, проф.; Савицкий В.К.,
зав. редакционно-издательским отделом; Сахарова З.Е., канд. экон. наук, доц.;
Слижов Ю.Г., канд. хим. наук, доц.; Сумарокова В.С., директор Издательства
ТГУ; Сущенко С.П., д-р техн. наук, проф.; Тарасенко Ф.П., д-р техн. наук,
проф.; Татьянин Г.М., канд. геол.-минерал. наук, доц.; Унгер Ф.Г., д-р хим.
наук, проф.; Уткин В.А., д-р юрид. наук, проф.; Шилько В.Г., д-р пед. наук,
проф.; Шрагер Э.Р., д-р техн. наук, проф.
РЕДАКЦИОННАЯ КОЛЛЕГИЯ ЖУРНАЛА
«ВЕСТНИК ТОМСКОГО ГОСУДАРСТВЕННОГО УНИВЕРСИТЕТА.
БИОЛОГИЯ»
Кулижский С.П., д-р биол. наук, проф., зав. каф. почвоведения и экологии
почв, директор Биологического института (председатель); Астафурова Т.П.,
д-р биол. наук, проф., зав. каф. агрономии, директор Сибирского ботанического
сада ТГУ (зам. председателя); Гуреева И.И., д-р биол. наук, проф., зав. Гербарием П.Н. Крылова (зам. председателя); Москвитина Н.С., д-р биол. наук, проф.,
зав. каф. зоологии позвоночных и экологии (зам. председателя); Акимова Е.Е.,
канд. биол. наук, старший преподаватель кафедры экологической и сельскохозяйственной биотехнологии ТГУ (отв. секретарь); Кривова Н.А., д-р биол.
наук, проф., директор ОСП «НИИ ББ ТомГУ»; Бушов Ю.В., д-р биол. наук,
проф., зав. каф. физиологии человека и животных; Данченко А.М., д-р биол.
наук, проф., зав. каф. лесоведения и зеленого строительства; Карначук Р.А., д-р
биол. наук, проф., зав. каф. физиологии и биотехнологии растений; Пяк А.И.,
д-р биол. наук, проф. каф. ботаники; Свиридова Т.П., канд. биол. наук, зам.
директора Сибирского ботанического сада ТГУ; Стегний В.Н., д-р биол. наук,
проф., зав. каф. цитологии и генетики.
© Томский государственный университет, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология
2011
№ 4 (16)
СОДЕРЖАНИЕ
АГРОХИМИЯ И ПОЧВОВЕДЕНИЕ
Некрасова О.А., Дергачева М.И. Содержание микроэлементов в черноземах
обыкновенных и их гуминовых кислотах (на примере Южного Урала) ..................... 7
Середина В.П., Садыков М.Е., Блохина C.Л. Физическое состояние фоновых почв
нефтяных месторождений средней тайги Западной Сибири....................................... 17
БОТАНИКА
Бабешина Л.Г., Кузнецов А.A. Морфология спор и спорогонов некоторых видов
сфагновых мхов, встречающихся на территории Западно-Сибирской равнины........ 30
Бордей Р.Х., Шепелева Л.Ф. Характеристика флоры г. Сургута..................................... 43
Олонова М.В., Храброва Н.В. Исследование генетического сходства Poa nemoralis L.
и Рoa palustris L. (Роасеае) на базе нуклеотидных
последовательностей района ETS 18S-26S ядерной рибосомной ДНК...................... 55
ЗООЛОГИЯ
Ананин А.А. Влияние фенологических сроков весны на формирование гнездового
населения птиц в ландшафтно-зональных условиях гор Северо-Восточного
Прибайкалья...................................................................................................................... 66
Шкурихин А.О., Ослина Т.С., Захарова Е.Ю. Протандрия монои поливольтинных видов белянок и бархатниц (Lepidoptera, Pieridae, Satyridae)
в условиях Южно-Уральской лесостепи........................................................................ 80
ФИЗИОЛОГИЯ И БИОХИМИЯ РАСТЕНИЙ
Алобайди Х.Х., Башмакова Е.Б., Холодова В.П. Сравнительный анализ
устойчивости растений рода Brassica на начальном этапе онтогенеза
к избытку меди.................................................................................................................. 92
Мараей М.М., Ралдугина Г.Н., Холодова В.П. Сравнительный анализ
устойчивости двух сортов ярового рапса (Brassica napus L.) к действию высоких
концентраций цинка......................................................................................................... 96
Удинцев С.Н., Бурмистрова Т.И., Заболотская А.В., Жилякова Т.П. Механизмы
индукции резистентности растений к фитопатогенам гуминовыми веществами.... 100
Хасан Д., Ковтун И.С., Ефимова М.В. Влияние хлоридного засоления
на прорастание семян и рост проростков Brassica napus L. . .................................... 108
ФИЗИОЛОГИЯ ЧЕЛОВЕКА И ЖИВОТНЫХ
Князева И.Р., Иванов В.В., Жаркова Л.П., Кутенков О.П., Ростов В.В.,
Большаков М.А. Влияние импульсно-периодического микроволнового излучения
на функциональную активность изолированных митохондрий печени мышей ......113
Лапирова Т.Б. Реакция иммунофизиологических показателей молоди сибирского
осетра (Acipenser baerii Brandt) на действие перметрина ......................................... 124
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Медведев К.Е., Афонников Д.А., Воробьев Ю.Н. Изучение методами
молекулярной динамики структур белков Nip7 глубоководных и мелководных
архей в условиях повышенного давления.................................................................... 136
Томова Т.А., Просекина Е.Ю., Гриднева В.И., Замощина Т.А. Модуляция
пептидами пролилглицилпролином и глицилпролином холинергических влияний
на секреторную активность желудка............................................................................ 146
ЦИТОЛОГИЯ И ГЕНЕТИКА
Артемов Г.Н., Абылкасымова Г.М., Стегний В.Н. Молекулярно-цитогенетический
анализ района прикрепления хромосом к ядерной оболочке трофоцитов
малярийных комаров Anopheles комплекса «maculipennis»........................................ 157
Гунбин К.В., Генаев М.А., Турнаев И.И., Афонников Д.А. Компьютерная система
анализа режимов молекулярной эволюции генов и белков: анализ эволюции
циклинов B...................................................................................................................... 170
РЕЦЕНЗИИ, КРИТИКА, БИБЛИОГРАФИЯ
Таран Г.С. Г.Д. Дымина. Классификация, динамика и онтогенез фитоценозов
(на примере регионов Сибири). (Новосибирск: Изд-во НГПУ, 2010. 213 с.)........... 185
СВЕДЕНИЯ ОБ АВТОРАХ............................................................................................... 197
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Tomsk State University Journal of Biology
2011
№ 4 (16)
CONTENTS
AGROCHEMISTRY AND SOIL SCIENCE
Nekrasova O.A., Dergacheva M.I. The amount of trace elements in ordinary chernozem
and their humic acids (on an example of South Urals) ....................................................... 7
Seredina V.P., Sadikov M.E., Blokhina S.V. Physical state of background soils
of oil fields of the middle taiga of Westen Siberia.............................................................. 17
BOTANY
Babeshina L.G., Kuznetsov A.A. Morphology of spores and moss-capsules of some species
of sphagnous mosses met at the territory of West-Siberian plain....................................... 30
Bordey R.K., Shepeleva L.F. Surgut flora description............................................................ 43
Olonova M.V., Khrabrova N.V. Research of genetic similarity of Poa nemoralis L.
and Рoa palustris L. (Роасеае), based on ETS of 18S-26S NR DNA sequence data........ 55
ZOOLOGY
Ananin A.A. The influence of spring phenological terms upon formation of the bird
nested population in landshaft-zone gradient of North-Еast Pribaikalye mountains......... 66
Shkurikhin A.O., Oslina T.S., Zakharova E.Yu. Protandry in mono- and polyvoltine
whites and satyrs species (Lepidoptera, Pieridae, Satyridae) from the South Urals
forest-steppe zone............................................................................................................... 80
PLANT PHYSIOLOGY AND BIOCHEMISTRY
Alobadi Kh.H., Bashmakova E.B., Kholodova V.P. A comparative analysis
of resistance of three species of the genus Brassica to excess copper concentration
at the initial stage of ontogenesis . ..................................................................................... 92
Маree M.M., Raldogena G.N., Kholodova V. P. Comparative analysis of the stability
of two types of spring rape (Brassica napus L.) to the action of the ions zinc ................. 96
Udintsev S.N., Burmistrova T.I., Zabolotskaya A.V., Zhilyakova T.P. The mechanisms
of induction of plants resistance to phytopatogens with humic substances..................... 100
Hasan D., Kovtun I.S., Efimova M.V. The influence of chloride salinization
on seeds germination and seedlings growth of Brassica napus L.................................... 108
HUMAN AND ANIMAL PHYSIOLOGY
Knyazeva I.R., Ivanov V.V., Zharkova L.P., Kutenkov O.P., Rostov V.V. ,
Bolshakov M.A. The effect of the repetitive pulsed microwaves on functional activity
of isolated mitochondria of mice liver.............................................................................. 113
Lapirova T.B. Reaction of siberian sturge fingerling (Acipenser baerii Brandt)
immunophisiological indicators to the permethrin action................................................ 124
Medvedev K.E., Afonnikov D.A., Vorobjev Yu.N. Molecular dynamics study of high
pressure influence on the structure of Nip7 protein from deep-sea
and shallow-water archaea................................................................................................ 136
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Tomova T.A., Prosekina E.Ju, Gridneva V.I., Zamoshchina T.A. The modulation
of cholinergic influences on gastric secretory activity by peptides prolilglycilprolin
and glycilprolin . .............................................................................................................. 146
CYTOLOGY AND GENETICS
Artemov G.N., Abilkasimova G.M., Stegniy V.N. Molecular-cytogenetic analysis
of chromosome attachment regions to nurse cells nuclear envelope in Anopheles
malaria mosquitoes of “maculipennis” subgroup............................................................. 157
Gunbin K.V., Genaev M.A., Turnaev I.I., Afonnikov D.A. Computer system
for analysis of molecular evolution modes of genes and proteins: a case study
of the cyclin B molecular evolution................................................................................. 170
REVIEWS, CRITIQUES, BIBLIOGRAPHY
Taran G.S. G. D. DYMINA. Classification, dynamics and ontogeny of phytocoenoses
(on the examples of regions of Siberia). Novosibirsk: NSPU PRESS, 2010. 213 р........ 185
INFORMATION ABOUT THE AUTHORS...................................................................... 197
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 7–16
АГРОХИМИЯ И ПОЧВОВЕДЕНИЕ
УДК 631.417
О.А. Некрасова1, М.И. Дергачева2
Уральский федеральный университет имени первого
Президента России Б.Н. Ельцина (г. Екатеринбург)
2
Институт почвоведения и агрохимии СО РАН (г. Новосибирск);
Биологический институт Томского государственного университета (г. Томск)
1
СОДЕРЖАНИЕ МИКРОЭЛЕМЕНТОВ В ЧЕРНОЗЕМАХ
ОБЫКНОВЕННЫХ И ИХ ГУМИНОВЫХ КИСЛОТАХ
(НА ПРИМЕРЕ ЮЖНОГО УРАЛА)
Работа выполнена при финансовой поддержке Министерства образования и науки РФ
в рамках ФЦП «Научные и научно-педагогические кадры инновационной
России» на 2009–2013 гг. (ГК № П2192 от 09.11.2009).
Проведена оценка вклада гуминовых кислот (ГК) в связывание микроэлементов (в том числе тяжелых металлов) черноземами обыкновенными. Предложен
подход к непосредственной оценке доли связанных гуминовыми кислотами микроэлементов в их общем почвенном пуле, который включает пересчет содержания
отдельных микроэлементов в препаратах ГК на углерод гуминовых кислот почвы
(в мг/кг) и последующее соотнесение их количеств. При пересчетах учитывались
содержание общего органического углерода в почве, доля гуминовых кислот в составе гумуса, содержание микроэлементов и мас. % углерода в препаратах ГК.
Незначительное превышение ПДК в черноземах обыкновенных выявлено только для Mo, Zn и Pb. Из часто встречающихся в почвах Южного Урала
микроэлементов As и Hg не обнаружены ни в почвах, ни в гуминовых кислотах.
В последних отсутствуют также Cd и Co. Доля микроэлементов в черноземе
обыкновенном Южного Урала, приходящаяся на гуминовые кислоты, уменьшается в ряду Cu > Mo > Cr > Zn >Ni > Pb > Ti > V. В незначительных количествах
выявлены элементы, связанные с ними (Mn, Ag). Общая доля микроэлементов,
обнаруженных в гуминовых кислотах, в среднем составляет около 25% от общего их содержания в почвах.
Ключевые слова: черноземы; гуминовые кислоты; микроэлементы.
Введение
Микроэлементный состав почвенной массы черноземов обыкновенных,
составляющих большой процент площадей в структуре почвенного покрова
степной части Южного Урала, в целом освящен в литературе, однако вопросы, касающиеся вклада отдельных почвенных компонентов в формирование и
накопление микроэлементов, в том числе тяжелых металлов (ТМ), отражены в
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
8
О.А. Некрасова, М.И. Дергачева
недостаточной степени. Это касается и такого компонента почв, как гумус, который в минеральных горизонтах может содержать до 50% от общего содержания
микроэлементов в почве [1]. Выявлена положительная связь между содержанием гумуса и концентрацией микроэлементов. Имеются данные, что гумусовые
вещества способны сорбировать от 1 до 100% валового количества меди и до
40% молибдена [1, 2]. Большое количество разнообразных функциональных
групп в гуминовых кислотах, имеющих сродство с ионами металлов, среди которых главенствующую роль, как свидетельствует большинство исследований,
играют карбоксильные и фенольные группы [3], позволяет тяжелым металлам
образовывать с этим компонентом почв соединения различной природы. Взаимодействия между металлами и гумусовыми веществами могут происходить
разными путями: ионного обмена, сорбции на поверхности, хелатообразования,
сокоагуляции и пептизации и др. [1, 2]. Органическое вещество почвы может
также образовывать связи с анионогенными элементами, такими как B, I, Se.
Микроэлементы, в том числе и тяжелые металлы, могут связываться с гуминовыми кислотами через различные гетероатомы, такие как азот, кислород, сера.
Гуминовые кислоты образуют как отчасти растворимые комплексы с металлами (с Mn, Co, Ni), так и комплексы, нерастворимые в воде (с Cu, Fe и Cr). Из
всех ионов металлов наибольшее удержание гуминовой кислотой наблюдается
у Fe, Cu, Zn. Установлено, что чем ниже содержание металла, тем выше энергия
образования металлоорганических соединений.
Несмотря на сравнительно большую информацию о способности гуминовых кислот связывать микроэлементы [1, 2, 4–8], абсолютное большинство сведений принадлежит лабораторным экспериментам, проводимым с
выделенными из почвы гумусовыми кислотами. Имеющиеся немногочисленные количественные микроэлементные характеристики препаратов гуминовых кислот до сих пор не позволяли непосредственно оценить долю
вклада этого компонента гумуса в общий пул микроэлементов в почвах, поскольку это требовало введения единой для почв и гумусовых веществ количественной основы, дающей возможность их сопоставления.
В настоящей статье предлагается подход к оценке доли вклада гуминовых кислот в общий микроэлементный пул почвы на примере черноземов
обыкновенных степной зоны Южного Урала.
Материалы и методики исследования
Изучался микроэлементный состав черноземов обыкновенных, распространенных на относительно незагрязненной тяжелыми металлами территории заповедной зоны «Аркаим» (Челябинская область) [9], а также выделенных из их
верхней среднесуглинистого состава 40–50-сантиметровой толщи гуминовых
кислот. Только изучая содержание ТМ и других микроэлементов в почвах и
их гуминовых кислотах на относительно чистых территориях, можно оценить
способность одного из компонентов гумусовых веществ в их связывании, при
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Содержание микроэлементов в черноземах обыкновенных
9
этом полученные результаты будут свидетельствовать о возможностях ГК в конкретных ландшафтных условиях. Почвы сформированы в условиях целинной
полынно-типчаково-ковыльной степи, проективное покрытие травянистого яруса которой составляет 60–70%. Почвы содержат в горизонте А в среднем 6–8%
общего органического углерода, четверть из которого приходится на гуминовые
кислоты, выделяемые щелочным гидролизом после декальцирования (23–25%).
Обуглероженность гуминовых кислот верхних гумусовых горизонтов варьирует от 50 до 56% от массы препарата. Имеются сведения, что состав
ГК в верхней гумусированной толще почвенного профиля характеризуется
следующими среднестатистическими величинами: С = 53,7 ± 0,62; H = 3,5±
± 0,59%; O = 39,3 ± 0,81%; N = 3,5 ± 0,59 мас. % [10].
Почвенные образцы отбирались сплошной колонкой каждые 2–10 см в пределах границ генетических горизонтов. Гуминовые кислоты выделялись из 0,1n
NaOH вытяжки после предварительного декальцирования путем их осаждения
2n HCl с последующим растворением в щелочи и переосаждением [11]. Содержание общего органического углерода определялось по Тюрину, доля углерода
гуминовых кислот – по Пономаревой – Плотниковой [12]. Микроэлементный состав почв и их важнейшего компонента – гуминовых кислот – определялся атомно-эмиссионным спектральным методом с использованием зоны до слияния
струй в двухструйном дуговом плазмотроне, что позволило в единых условиях
по одному и тому же набору образцов сравнения на основе графитового порошка
проанализировать почвы и гуминовые кислоты. Примененная методика основана на том, что в зоне до слияния струй в двухструйном дуговом плазмотроне
(который позволяет анализировать не только растворы, но и порошковые пробы)
могут быть созданы условия, обеспечивающие независимость аналитического
сигнала от состава проб, причем добавка к пробе 15% NaCl позволяет не только
увеличить интенсивность аналитических линий, но и подавить матричные влияния [13]. Определение микроэлементного состава в гуминовых кислотах проводилось непосредственно в порошковых препаратах. Для проверки правильности
анализа и влияния органической матрицы определение дублировалось после их
предварительного озоления при t = 500–550°С в течение 2–3 ч. Стабильные количественные результаты при прямом определении элементов в порошке получены для большинства элементов всех гуминовых кислот, исключая бор и фосфор,
результаты определения которых не обсуждаются. Погрешность анализа характеризуется относительным стандартным отклонением – 0,05–0,2.
Элементный состав гуминовых кислот определялся в аналитической лаборатории НИОХ СО РАН (Новосибирский институт органической химии
им. Н.Н. Ворожцова) под руководством доктора химических наук В.П. Фадеевой на автоматических элементных СНN-анализаторах фирмы Hewlett
Packard mod.185 и фирмы Carlo Erba mod.1106 и дублировался классическим
методом по Преглю.
Содержание отдельных микроэлементов в препаратах гуминовых кислот
было пересчитано на углерод ГК почвы (в мг/кг), для чего учитывалось содер-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
О.А. Некрасова, М.И. Дергачева
10
жание общего органического углерода в почве, доля гуминовых кислот в составе гумуса, содержание микроэлементов и мас. % углерода в препарате ГК.
Параллельное изучение едиными методами и методическими приёмами
содержания основных микроэлементов в почвах и гуминовых кислотах при
наличии данных о доле этого компонента в почвах и его элементного состава позволяет проводить количественные сопоставления и непосредственно
оценить долю микроэлементов, связанных гуминовыми кислотами, в общем
микроэлементном пуле почв.
Результаты исследования и обсуждение
Анализ результатов микроэлементного состава черноземов обыкновенных (табл. 1) позволяет отметить, что несмотря на варьирование содержания отдельных элементов, в целом почвы не загрязнены. Однако отдельные
определения показали превышение ПДК, что сказалось на среднестатистических величинах содержания таких микроэлементов, как Mo, Zn, Pb, которые, хотя и незначительно, лежат выше границы возможных предельных
их концентраций. Считается, что содержание молибдена в почвах обычно
близко к его концентрации в материнских породах.
В почвах мира количество этого элемента варьирует в пределах 0,013–
17,0 мг/кг. В нашем случае его содержание колеблется в пределах 4–8 мг/кг
почвы. В то же время содержание большинства микроэлементов-загрязнителей, таких как хрома, меди, марганца, никеля, ванадия, титана, кобальта и
кадмия, лежит ниже величины ПДК (табл. 2).
Микроэлементный состав черноземов обыкновенных*
Глубина,
см
2
Ag
3
0–5
5–10
10–16
16–20
2
0,6
0,6
3
0–3
3–10
10–15
15–20
20–25
25–32
32–39
<0,5
0,5
0,5
0,3
0,3
0,3
0,6
0–3
3–10
А
10–15
15–20
* По Kloke, 1980.
0,5
0,7
0,6
0,5
Горизонт
1
Ад
А
АВ
Ад
А
АВ
Ад
Таблица 1
Содержание микроэлементов в почве, мг/кг
Cu Mn Mo Zn Ni Pb
V
Ti
5
6
7
8
9 10 11
12
Разрез 9511
100 40 520
8
90 50 50 130 1 900
100 40 540
8
90 50 40 150 2 100
90 30 560
8
60 50 30 140 2 600
70 30 470
6
40 50 30 90 1 500
Разрез 9512
70 40 800
4
110 40 40 100 1 500
80 30 1 000 4
70 40 30 120 2 000
80 40 700
4
90 50 30 100 1 500
100 30 700
5
100 70 40 150 2 900
80 20 400
4
90 40 30 80 1 300
100 50 700
4
120 50 60 80 1 700
120 50 600
6
130 90 40 100 2 000
Разрез 9513
130 60 600
8
140 80 40 160 2 500
100 40 800
6
100 80 30 140 2 000
100 50 300
5
80 70 30 110 2 000
100 40 800
5
70 70 30 90 1 000
Cr
4
Co
13
19
24
25
18
20
20
20
30
20
20
50
20
3
20
20
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Содержание микроэлементов в черноземах обыкновенных
11
Из часто встречающихся в почвах Южного Урала микроэлементов [9] As
и Hg в почвах не обнаружены. Из наиболее распространенных загрязняющих элементов, среди которых, по мнению Ю.В. Алексеева [14], преобладают цинк, свинец, хром, ртуть и кадмий, в изученных почвах в количествах,
близких к ПДК или превышающих их, содержатся только цинк и свинец,
остальные лежат в пределах ПДК. В общем, результаты показывают, что за
содержанием трех элементов – молибденом, цинком и свинцом – требуется
слежение.
В гуминовых кислотах черноземов обыкновенных не обнаружены следующие элементы: Be, Bi, Cd, Y – <3·10–5%; In, Nb, Sc, Pd – <3·10–4%; Au, Co,
Ge, Hf, Pt – < 4·10–4%; La, Sb, Та, Те, W– < 1·10–3%; As, Hg – <3·10–3%. Таким
образом, из наиболее распространенных и изучаемых микроэлементов в гуминовых кислотах не обнаружены Cd, Co, As и Hg.
Таблица 2
Среднестатистическое содержание элементов в черноземе обыкновенном
Элемент
n
Среднестатистическое содержание
ПДК
Ag
15
0,79±0,14
Нет данных
Cr
15
94,7±16,3
150
Cu
15
39,3±10,3
100*
Mn
15
632,7±179,9
1 500
Mo
15
5,7±1,6
5,0
Zn
15
92,0±26,5
100
Ni
15
58,7±16,4
85
Pb
15
36,7±9,0
32
V
15
116,0±27,2
150
Ti
15
1 900±508,5
5 000
Co
15
21,9±9,6
50*
Cd**
8
0,79±0,20
5,0
* По Kloke, 1980.
** Вычислено по результатам изучения содержания Cd в черноземе обыкновенном,
вскрытом разрезом 9510.
Все изученные препараты гуминовых кислот в наибольшем количестве
в своем составе содержат Ti и Cu, причем из 13 случаев в 8 преобладает Ti,
в 5 – Cu (табл. 3). По средним данным преобладает Ti, содержание которого
составляет 5,4 мг/кг, что на 0,7 мг/кг превышает таковое меди. Количество
остальных элементов на порядок меньше и колеблется от 0,6 до 0,1 мг/кг.
Составленный по средним данным ряд содержания микроэлементов по мере
убывания их количества (в мг/кг) имеет следующий вид: Ti > Cu > Cr > Mo >
Zn > Ni > V > Pb > Mn, причем два последних элемента связываются гуминовыми кислотами в минимальных количествах, не превышающих 0,1 мг/кг.
Наибольшая доля среди связанных гуминовыми кислотами микроэлементов характерна для Cu. В среднем на ГК приходится почти 14% этого
элемента от валового его содержания в почве, при этом максимальная доля
близка к 52%, а минимальная – не превышает 2%. Способность ГК образовывать устойчивые соединения с медью отмечалась для этого элемента
ранее [1]. Установлено, что на долю органического вещества в черноземе
26,6
1,88
–
15–20
В 20–25-сантиметровой
толще
–
28,5
23,3
23,5
45,9
54,3
46,1
44,0
31,9
18,5
33,9
33,5
30,5
%ГК
2,01
10–15
* Среднее из 2–5 повторностей.
Среднее
А
Ад
3,19
1,84
20–25
3–10
2,66
15–20
6,45
3,48
10–15
0–3
5,27
3–10
А
7,75
0–3
Ад
2,83
10–16
2,16
4,91
5–10
16–20
7,19
0–5
Глубина, см Собщ., %
–
50,9
55,5
52,6
54,6
54,0
53,0
55,5
50,0
51,5
52,5
53,6
52,1
56,0
мас. %
С в ГК*
–
0,59
0,71
4,73
13,96
0,10
0,10
0,468,9
0,42
0,52
0,23
0,51
0,11
0,32
0,13
0,10
5,38
0,29
Содержание микроэлементов, пересчитанное на углерод ГК почвы: в числителе – в мг/кг,
в знаменателе – процент от валового
Ag
Cr
Cu
Mn
Mo
Zn
Ni
Pb
V
Ti
Разрез 9511
0,01
1,17
5,09
0,16
1,17
0,16
0,35
0,39
0,16
5,87
0,5
1,7
12,7
<0,1
14,6
0,18
0,7
0,8
0,1
0,3
0,00
0,63
3,16
0,16
0,63
0,63
0,28
0,32
0,03
9,47
0,0
0,6
7,9
<0,1
7,9
0,7
0,6
0,8
<0,1
0,5
0,01
0,36
1,79
0,04
0,04
0,11
0,07
0,04
0,05
3,58
1,7
0,4
6,0
<0,1
0,5
0,2
0,1
0,1
<0,1
0,1
0,00
0,38
0,02
0,02
0,02
0,69
0,15
0,02
0,23
4,57
0,0
0,5
0,1
0,0
0,3
1,7
0,3
0,1
0,3
0,3
Разрез 9512
0,02
0,96
20,64
0,10
0,96
0,24
0,48
0,10
0,07
1,92
4,0
1,4
51,6
<0,1
24,0
0,2
1,2
0,3
0,1
0,1
0,02
1,39
10,20
0,19
0,93
0,23
0,70
0,14
0,28
6,03
4,0
1,7
34,0
<0,1
23,3
0,3
1,8
0,5
0,2
0,3
0,01
0,58
4,62
0,12
0,58
1,16
0,29
0,06
0,09
3,47
2,0
0,7
11,6
<0,1
14,5
1,3
0,6
0,2
0,1
0,2
0,01
0,58
4,62
0,12
0,58
1,16
0,29
0,06
0,09
3,47
3,3
0,6
15,4
<0,1
11,6
1,2
0,4
0,2
0,1
0,1
0,00
0,47
6,26
0,23
0,31
0,31
0,16
0,05
0,16
7,04
0,0
0,6
31,3
0,1
7,8
0,3
0,4
0,2
0,2
0,5
Разрез 9513
0,01
0,28
1,67
0,06
0,56
0,56
0,14
0,28
4,72
Не опр.
2,0
0,2
2,8
<0,1
7,0
0,4
0,2
0,7
0,2
0,00
0,14
0,71
0,04
0,03
0,14
0,03
0,01
11,30
Не опр.
0,0
0,1
1,8
<0,1
0,5
0,1
<0,1
<0,1
0,6
0,00
0,21
1,03
0,02
0,02
0,04
0,02
0,01
0,62
Не опр.
0,0
0,2
2,1
<0,1
0,4
0,1
<0,1
<0,1
<0,1
0,00
0,49
1,67
0,06
0,20
0,04
0,09
0,01
4,91
Не опр.
0,0
0,5
4,2
<0,1
4,0
0,1
0,1
<0,1
0,5
Таблица 3
12
АВ
А
Ад
Горизонт
Содержание микроэлементов в гуминовых кислотах почв*
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
О.А. Некрасова, М.И. Дергачева
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Содержание микроэлементов в черноземах обыкновенных
13
выщелоченном Западной Сибири приходится 32–36% валового содержания
меди, при этом гуминовые кислоты связывают около 10% от этого количества [4]. Таким образом, полученные для ГК чернозема обыкновенного Южного Урала уровни содержания меди сопоставимы с известными литературными данными, расширяя, однако, диапазон возможного уровня связывания
Cu этим компонентом.
Следующим по доле связанного ГК количества микроэлемента является
Mo. Гуминовые кислоты черноземов обыкновенных Южного Урала вносят
значительный вклад в связывание Mo: от 0,3 до 24% (в среднем 8,9%) от
валового содержания в почве этого микроэлемента приходится на них, что
больше, чем в 2 раза, но меньше значений, полученных для более северных
черноземов другими исследователями [4].
Остальные микроэлементы обнаружены в составе гуминовых кислот в
существенно меньших количествах, на порядок более низких, чем предыдущие. Так, на долю гуминовых кислот приходится не более 1,7% хрома (в
среднем около 0,7%) от содержащегося в почве, что согласуется с представлениями о том, что большая часть хрома в почвах присутствует в виде Сr+3,
входящего в состав минералов или присутствующих в виде оксидов.
Гуминовые кислоты удерживают в среднем 0,5% от валового содержания
цинка. Количественные оценки распределения Zn по почвенным компонентам других авторов [15] показывают, что органические комплексы цинка
составляют 1,5–2,3%. Полученные нами результаты подтверждают возможность гуминовых кислот черноземов обыкновенных связывать этот элемент
в небольших количествах. Вклад гуминовых кислот в связывание никеля
почвой в среднем составляет, как и предыдущего, 0,5%. Имеются сведения,
что степень связывания этого металла с органическими лигандами не может
быть особенно высокой [1], хотя указывается, что органическое вещество
способно мобилизовывать никель из карбонатов и оксидов, а также уменьшать его сорбцию глинами. Несмотря на то что в распределении никеля и
кобальта в земной коре имеется большое сходство, последний микроэлемент
в гуминовых кислотах изученных черноземов обнаружен не был.
Максимальный вклад гуминовых кислот в связывание свинца не превышает 1%. Это и понятно, поскольку считается, что Pb адсорбируется главным образом глинистыми минералами, оксидами Mn, гидроксидами Fe и
Al. Есть указания на участие в этом процессе органического вещества. Но
органическое вещество как важный иммобилизатор Pb рассматривается для
загрязненных почв. Возможно, что превышение количеств этого микроэлемента его ПДК столь незначительны, что почвы можно отнести только к
объектам слабого загрязнения по этому элементу, и ГК не играют ведущей
роли в его связывании, количество которого в этом компоненте гумуса в
среднем составляет 0,3% от валового его содержания в почве.
Уровни накопления титана гуминовыми кислотами изменяются в пределах 0,1–0,6% от валового содержания в почве, хотя абсолютные его количе-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
14
О.А. Некрасова, М.И. Дергачева
ства превышают во многих ГК содержание преобладающего в них микроэлемента меди. Таким образом, ГК почв активно связывают Ti, но доля их
в этом процессе не столь значительна (не превышает в среднем 0,29% от
валового его содержания в почве) вследствие высокого валового содержания
этого элемента в почве в составе различных минералов.
Ванадий преимущественно приурочен к основным породам и сланцам, в изучаемых черноземах обыкновенных его содержание достаточно велико и варьирует от 80 до 160 мг/кг (см. табл. 1). Гуминовые кислоты накапливают в своем
составе лишь 0,1–0,2% от этого количества, причем и абсолютное содержание
этого микроэлемента в составе ГК достаточно низкое (см. табл. 3).
В большинстве почв мира количество марганца находится в пределах
200–800 мг/кг. Уровни содержания этого элемента в изученных черноземах
обыкновенных варьируют в пределах 400–1000 мг/кг почвы. Гуминовые
кислоты удерживают от этого количества лишь доли миллиграммов, что соответствует менее 0,1% от общего его содержания.
Средние концентрации серебра в мировых почвах лежат в пределах
0,01–8 мг/кг. В большинстве случаев содержание серебра в исследуемых
степных почвах составляет не более 0,6 мг/кг, в единичных – 2–3 мг/кг. В то
же время доля связанных с гуминовыми кислотами Ag не превышает 4%
от валового его содержания в почве, но часто этот элемент в составе ГК не
обнаруживается.
Заключение
Таким образом, для гуминовых кислот черноземов обыкновенных Южного Урала определен микроэлементный состав, позволивший выявить уровень
накопления ряда элементов этим компонентом почв. Микроэлементы, обнаруженные в гуминовых кислотах, могут быть расположены в порядке уменьшения их содержания: Cu > Mo > Cr > Zn >Ni > Pb > Ti > V> Mn. Самые
незначительные количества в составе ГК (< 0,1% от валового содержания в
почве) обнаружены для Mn. Серебро связывается лишь гуминовыми кислотами верхней части гумусовой толщи. Такие элементы, как Cd, Co, As и Hg,
не связываются с основным компонентом гумуса черноземов обыкновенных.
Общая доля микроэлементов, обнаруженных в гуминовых кислотах, в среднем составляет около 25% от общего их содержания в почвах.
Накопление статистически значимого массива данных в дальнейшем позволит оценить вклад гуминовых кислот, формирующихся в разных экологических условиях, в биогеоценотические и глобальные функции, выполняемые почвами по отношению к различным природным средам.
Литература
1. Кабата-Пендиас А., Пендиас Х. Микроэлементы в почвах и растениях. М. : Мир, 1989. 439 с.
2. Манская С.М., Дроздова Т.В. Геохимия органического вещества. М. : Наука, 1964. 314 с.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Содержание микроэлементов в черноземах обыкновенных
15
3. Merdy P., Huclier S., Koopal L.K. Modeling metal-particle interactions with an emphasis on
natural organic matter // Environ. Sci. Technol. 2006. Р. 7454–7466.
4. Степанова М.Д. Микроэлементы в органическом веществе почв. Новосибирск : Наука,
1976. 107 с.
5. Перельман А.И. Геохимия ландшафта. М. : Высшая школа, 1975. 496 с.
6. Мотузова Г.В. Соединения микроэлементов в почвах: системная организация, экологическое значение, мониторинг. М. : Эдиториал УРСС, 1999. 168 с.
7. Ильин В.Б., Сысо А.И. Микроэлементы и тяжелые металлы в почвах и растениях Новосибирской области. Новосибирск : Изд-во СО РАН, 2001. 229 с.
8. Дерхам Х.М. Взаимодействие тяжелых металлов (медь и цинк) с органическими и минеральными компонентами почв : автореф. дис. … канд. биол. наук. М., 2009. 16 с.
9. Еремченко О.З. Природно-антропогенные изменения солонцовых почв в Южном Зауралье. Пермь : Изд-во Перм. ун-та, 1997. 319 с.
10. Некрасова О.А., Дергачева М.И. Микроэлементный состав гуминовых кислот черноземов обыкновенных Большекарганской долины (Южный Урал) // Современные проблемы загрязнения почв. III Международная научная конференция : сб. материалов.
М., 2010. С. 263–266.
11. Дергачева М.И., Некрасова О.А., Лаврик Н.Л. Гуминовые кислоты современных почв
Южного Урала. Новосибирск, 2002. 24 с.
12. Пономарева В.В., Плотникова Т.А. Методические указания по определению содержания и состава гумуса в почвах. Л. : Изд. Почв. музея им. В.В. Докучаева, 1975. 105 с.
13. Заксас Н.П., Дергачева М.И., Шелпакова И.Р. Новые аналитические возможности
двухструйного дугового плазмотрона при изучении микроэлементного состава гуминовых кислот почв разного генезиса // Гуминовые вещества в биосфере : тезисы докл.
II Межд. конф. М. ; СПб., 2009. С. 36–37.
14. Алексеев Ю.В. Тяжелые металлы в почвах и растениях. Л. : Агропромиздат, 1987. 141 с.
15. Зырин Н.Г., Рерих В.И., Тихомиров Ф.А. Формы соединения цинка в почвах и поступление его в растения // Агрохимия. 1976. № 5. С. 124–132.
Поступила в редакцию 15.07.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 7–16
Olga A. Nekrasova1, Maria I. Dergacheva2
Ural Federal University named after the First President
of Russia B.N. Yeltsin, Ekaterinburg, Russia
2
Institute of Soil Science and Agrochemistry of Siberian Branch
of Russian Academy of Sciences, Novosibirsk, Russia;
Biological Institute of Tomsk State University, Tomsk, Russia
1
THE AMOUNT OF TRACE ELEMENTS IN ORDINARY CHERNOZEM
AND THEIR HUMIC ACIDS (ON AN EXAMPLE OF SOUTH URALS)
The amount of some trace elements in ordinary chernozems – the dominant soil type
of «Arkaim» reserve (South Ural) and their humic acids (HA) has been carried out.
The amount of trace elements being in soil, including heavy metals, is considerable,
however the data about maintenance of various amount of trace elements in their humic
acids is rather not numerous.
The level of humus (the amount of general organic carbon in the top 15-sm layer –
6–9%) and humic acids content of humus horizon in soils studiing is high. Humic acids
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
16
О.А. Некрасова, М.И. Дергачева
fractions 1+2 make the greatest share from the general organic soil carbon of 23–25%
in humus horizons. Their own carbon content varies from 50 to 56% from weight of a
preparation. Humic acids were allocated from 0,1n NaOH extracts after preliminary
decalcition by their sedimentation 2n HCl, with the subsequent dissolution in alkali
and resedimentation. The trace elements structure of soils and their major component –
humic acids was defined by an atomno-issue spectral method.
The amount of separate elements in the same horizons of ordinary chernozems can
sometimes differ almost in 2 times (Cr, Mo, V). This fact is marked for soils of steppe
and forest-steppe conditions. The concentration variation in big limits of the majority
trace elements in the same soil types is connected with distinctions in humus content,
рН, absorption capacities, soil structure, CaCO3 content. The average maintenance
of defined elements lies in the limits which are not exceeding maximum concentration
limit. Though the territory of South Ural tests considerable anthropogenous loading,
soils are not polluted. Insignificant excess of maximum concentration limit in ordinary
chernozems is revealed only for Mo, Zn and Pb. As and Hg, trace elements that are
often met in Southern Ural,s soils aren’t found out neither in soils, nor in humic acids.
The maintenance of separate trace elements in preparations humic acids has been
counted for soil HA carbon (in mg/kg). The content of the general organic carbon
in soil, humic acid percent, the amount of trace elements in HA preparation and
mass carbon % in HA was considered for this purpose. Similar recalculation allows
to estimate the contribution of humic acids in linkage of trace elements by soils. The
order of linkage decreasing of trace elements by humic acids of ordinary chernozem
is established: Cu > Mo > Cr > Zn >Ni > Pb > Ti > V. The elements which are not
forming associations with humic acids of chernozem (Co, Sb), and also connected with
humic acids in insignificant quantities (Mn, Ag) are revealed. The general share of
trace elements which have been found out in humic acids, on the average makes about
25% from their general maintenance in soils.
Key words: chernozem; humic acids; trace elements.
Received July 15, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 17–29
УДК 631.41
В.П. Середина1, М.Е. Садыков2, C.Л. Блохина2
Биологический институт Томского государственного университета (г. Томск)
Томский научно-исследовательский и проектный институт нефти и газа (г. Томск)
1
2
ФИЗИЧЕСКОЕ СОСТОЯНИЕ ФОНОВЫХ ПОЧВ НЕФТЯНЫХ
МЕСТОРОЖДЕНИЙ СРЕДНЕЙ ТАЙГИ ЗАПАДНОЙ СИБИРИ
Представлены результаты полевых и экспериментальных исследований физических и водно-физических свойств фоновых почв нефтяных месторождений
средней тайги Западной Сибири. Установлено, что основным параметром физического состояния почв, от которого зависит структурное состояние и сложение, а следовательно, и устойчивость почв к техногенному загрязнению органическими поллютантами, является гранулометрический состав. Результаты
могут быть использованы при проведении почвенно-экологического мониторинга
и рекультивации почв.
Ключевые слова: фоновые почвы; Западная Сибирь; средняя тайга; нефтяные месторождения; физические свойства; ландшафт; устойчивость.
Введение
Западно-Сибирский регион на сегодняшний день является крупнейшим
в нашей стране источником нефтеуглеводородного сырья. Здесь на относительно небольшой площади сконцентрировано большое количество месторождений, активно ведутся разработка и освоение все новых территорий.
Увеличение объемов добычи нефти на территории Западной Сибири приводит к усилению техногенной нагрузки на все компоненты экосистемы, в том
числе и на почвы [1]. Во многих нефтегазоносных районах Западной Сибири
уже сейчас складывается крайне неблагоприятная экологическая ситуация,
которая с каждым годом ухудшается из-за учащающихся аварий на нефтепроводах. Нефтепромысловые районы Западной Сибири входят в число территорий с очень острыми экологическими ситуациями [2, 3]. Центральным звеном биосферной системы, узлом экологических связей, который объединяет
в единое целое другие составляющие этой системы, является почва. Все это
требует усиленного внимания к изучению фоновых (незагрязненных) природных ресурсов, в частности почв. Актуальность проведения углубленных
почвенно-экологических исследований с целью изучения почвенного покрова нефтяных месторождений и оценки устойчивости почв, обусловливается
высокой чувствительностью ландшафтов к техногенному воздействию и длительным сроком их восстановления. Создание и поддержание необходимого
уровня плодородия, в частности обеспеченности влагой, теплом и основными
элементами минерального питания растений, определяются комплексом фи-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
18
В.П. Середина, М.Е. Садыков, С.Л. Блохина
зических свойств почвы, который должен обеспечивать устойчивое функционирование почв не только с биогеоценотических позиций, но и как объекта
техногенных воздействий. Это позволяет говорить об устойчивости физических свойств к естественным и антропогенным воздействиям, т.е. способности сохранять в первую очередь структурное состояние и сложение, являющиеся интегральными показателями физического состояния почв.
Материалы и методики исследования
Территория исследований находится в подзоне средней тайги в пределах
Томской области и охватывает право- и левобережье среднего течения р. Оби.
Данная территория представляет собой два нефтегазоперспективных лицензионных участка по разведке и добыче залежей углеводородного сырья: на
левобережье Оби – Аленкинское, на правобережье – Кондаковское. Своеобразие природных условий (равнинность территории, положительный водный баланс, слабый отток поверхностных вод) способствует повышенному
гидроморфизму почв, прогрессивному заболачиванию и широкому развитию
процессов подзоло-, глее- и болотообразования. Почвенный покров исследуемой территории месторождений углеводородного сырья имеет сложное
строение. На основании новой Классификации и диагностики почв России
[4] в пределах изученной территории широкое распространение получили
почвы постлитогенного (текстурно-дифференцированного, альфегумусового отделов) и органогенного ствола (торфяного отдела). В соответствии с
Классификацией… [5, 6] почвенный покров представлен следующими типами почв: подзолистыми, болотно-подзолистыми и болотными. Почвенно-экологическое обследование территории нефтегазовых месторождений
осуществлялось методом маршрутов и ключевых участков. Аналитические
исследования выполнены с использованием общепринятых в почвоведении
методов. Основные параметры физического состояния определялись методами, изложенными в [7, 8]. Гранулометрический и микроагрегатный состав
выполнены пипеточным методом с использованием пирофосфата натрия [9].
Результаты исследования и обсуждение
Представление о структурных уровнях физического состояния почв базируется на основе взаимоотношений составляющих элементов почвенной
массы. На самых низких уровнях такими элементами являются элементарные почвенные частицы, соотношение которых в почве определяет ее гранулометрический состав [10]. Гранулометрический состав является одним из
главнейших показателей физического состояния, а также важными генетической и агрохимической характеристиками почв. Плодородие почв в значительной степени связано с гранулометрическим и структурно-агрегатным
составом. Гранулометрический состав почв, являясь результатом длитель-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Физическое состояние фоновых почв
19
ной истории формирования территории, отражает все этапы ее развития, а
также определяет технологические свойства почвы: твердость, прилипание
к почвообрабатывающим орудиям, плотность. Гранулометрический состав
глееподзолистых почв, формирующихся в пределах левобережной части
р. Оби, представлен различными разновидностями – от средних до тяжелых
суглинков (табл. 1).
Для данных почв характерно преобладание фракций мелкого песка, крупной пыли и ила. Специфической особенностью глееподзолистых почв является слабая выраженность подзолообразовательного процесса и дифференцированность на генетические горизонты. В распределении илистой фракции
наблюдается общее незначительное возрастание в средней и нижней части
профиля, что может быть обусловлено длительным или постоянным оглеением, приводящим к диспергации минеральной массы, нисходящим переносом
суспензий (процесс лессиважа) и литологической микрослоистостью профиля почвы. В исследованиях А.Г. Дюкарева [11] также указывается на слабую
дифференциацию глееподзолистых почв по гранулометрическому составу, и
связывается это с неоднородностью почвообразующих пород.
Характерной особенностью гранулометрического состава подзолистых
почв является более четкая дифференциация по элювиально-иллювиальному типу, и проявляется она прежде всего в распределении илистой фракции,
что находит отражение в строении иллювиальных горизонтов, верхняя часть
которых характеризуется достаточно выраженными признаками иллювиирования (ореховатой структурой, более плотным сложением). В целом подзолистые почвы имеют несбалансированный по илу профиль; иллювиальное
накопление, как правило, значительно выше обезыливания верхней толщи.
Как указывается в работах [12, 13], литологическая основа иллювиального
горизонта сформировалась значительно раньше матрицы элювиальных горизонтов и сочетает признаки современного и реликтового почвообразования.
На исследованной территории широкое распространение получили подзолистые почвы легкого (песчаного и супесчаного) гранулометрического
состава. Данные почвы формируются на террасах рек, наиболее дренируемых участках водоразделов, сложенных однородными или слабослоистыми
супесчаными и песчаными отложениями, под зеленомошно-кустарничковобагульниковым сосновым или кедровым лесом. В сочетании с легким гранулометрическим составом, кислой реакцией среды интенсивность процесса
подзолообразования в таких почвах усиливается, что особенно четко проявляется в характерных морфологических особенностях основных генетических горизонтов: белесый бесструктурный горизонт А2 и насыщенный
полуторными оксидами, органоминеральными соединениями и другими
продуктами миграции ржаво-охристый иллювиальный горизонт. Доминирующее значение в составе гранулометрических фракций данных почв имеют
песчаные фракции. Илистая фракция составляет всего лишь 4,4–7%, и в ее
профильном распределении не наблюдается четких закономерностей.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
20
В.П. Середина, М.Е. Садыков, С.Л. Блохина
Гранулометрический состав исследуемых почв, %
Таблица 1
Размер частиц, мм
0,25–
0,05–
0,01–
0,005–
<0,001 <0,01
0,05
0,01
0,005
0,001
1
2
3
4
5
6
7
8
9
Глееподзолистая обычная мелкая среднесуглинистая почва, разрез 111.06
A1А2
6–16
0,56
8,24
50,80
11,20
6,80
22,40
40,40
A2 Fe g
1–28
0,02
15,18
41,20
12,00
6,40
25,20
43,60
A2B Fe g
55–65
0,15
17,05
43,60
11,60
0,80
26,80
39,20
BC Fe g
95–05
0,35
12,85
49,60
0,40
13,60
23,20
37,20
С Fe g
125–135
0,11
10,69
42,80
10,00
6,80
29,60
46,40
Глееподзолистая обычная мелкая тяжелосуглинистая почва, разрез 106.06
A2g
3–13
0,91
26,69
29,60
8,80
7,20
26,80
42,80
A2g
1–23
0,48
45,12
12,40
7,60
8,00
26,40
42,00
A2Bg
30–40
0,19
37,01
21,60
5,20
7,20
28,80
41,20
B1g
6–575
0,24
26,56
33,60
5,20
6,80
27,60
39,60
BСFeg
130–140
0,31
36,09
15,60
8,80
7,60
31,60
48,00
Глубокоподзолистая обычная глинистая почва, разрез 100.06
A1A2
6–16
0,47
4,33
44,00
13,20
10,00
28,00
51,20
A2
30–40
0,08
21,52
37,20
2,00
8,80
30,40
41,20
A 2B
50–60
0,08
23,92
34,80
2,40
9,60
29,20
41,20
B1
70–80
0,12
28,68
23,60
7,60
7,20
32,80
47,60
B2
105–115
0,12
50,28
3,20
4,40
7,60
34,40
46,40
BC
140–155
0,17
43,03
15,60
2,00
5,20
34,00
41,20
Глубокоподзолистая супесчаная почва, разрез 7.06
А1А2
4–14
29,13
55,48
3,80
2,20
3,20
6,20
11,60
А2
19–29
35,18
51,82
2,60
2,00
1,20
7,20
10,40
А 2В
54–64
42,50
43,11
2,00
1,00
2,40
9,00
12,40
В
125–135 44,93
38,47
3,00
2,20
2,20
9,20
13,60
ВС
200–210 27,25
58,35
2,20
3,20
1,20
7,80
12,20
Мелкоподзолистая иллювиально-железистая глубокооглеенная песчаная почва,
разрез 4/1-07
А2
9–19
46,05 34,75
9,40
1,60
1,20
7,00
9,80
А2Вfe
32–42
32,94 45,46
8,60
1,80
2,20
9,00
13,00
Bfe
60–70
41,03 40,97
6,80
1,60
1,20
8,40
11,20
BСfeg
85–95
28,40 27,20
16,00
6,50
6,70
15,20
28,40
Мелкоподзолистая иллювиально-железистая языковатая песчаная почва, разрез 13/1-07
А2
6–13
28,16
46,24
16,40
2,40
2,40
4,40
9,20
А2Вfe
20–30
22,28
52,32
15,20
1,20
3,40
5,60
10,20
Вfe
60–70
38,26
51,74
1,80
0,20
1,20
6,80
8,20
ВСfe
100–110 39,02
51,79
2,40
1,20
0,00
5,60
6,80
Горизонт
Глубина,
см
1–0,25
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Физическое состояние фоновых почв
21
О к о н ч а н и е т а б л. 1
1
2
3
4
5
6
7
8
9
Торфянисто-глубокоподзолистая глеевая среднесуглинистая почва, разрез 5.06
А1
14–21
0,21
5,79
54,80
2,00
12,40
24,80
39,20
А2
38–48
0,10
20,30
40,40
2,00
10,00
27,20
39,20
А2ВFe g
70–80
0,02
26,78
34,00
3,60
7,20
28,40
39,20
В1Feg 104–114
0,03
21,57
40,80
2,80
8,40
26,40
37,60
ВСFeg 140–150
0,05
5,15
48,40
7,60
11,60
27,20
46,40
Торфянисто-мелкоподзолистая иллювиально-гумусовая профильно-оглееная
легкосуглинистая почва, разрез 6/1-07
А2
10–20
3,67
16,73
50,00
9,20
5,60
14,80
29,60
А2Вfe
25–35
1,44
18,96
50,00
7,20
6,40
16,00
29,60
Bfeg
45–55
0,70
18,50
50,40
8,00
7,60
14,80
30,40
Сfeg
70–80
0,05
24,75
42,80
5,20
5,60
21,60
32,40
Торфянисто-глубокоподзолистая языковатая иллювиально-железистая
глубокооглеенная песчаная почва, разрез 24/1-07
А2
35–45
23,37
53,83
13,60
2,20
2,40
4,60
9,20
В1fe
47–57
27,28
52,72
8,60
2,40
3,40
5,60
11,40
B2fe
90–100 29,84
56,96
4,20
0,40
1,20
7,40
9,00
BСfeg 110–120 37,14
49,86
3,40
0,40
0,40
8,80
9,60
Болотная низинная торфянисто-глеевая тяжелосуглинистая почва, разрез 6.06
А1
15–25
2,19
11,81
38,40
10,80
7,20
29,60
47,60
G1
51–61
0,38
16,02
38,40
10,80
3,60
30,80
45,20
Гранулометрический состав болотно-подзолистых почв по сравнению с
собственно подзолистыми почвами также имеет слабую дифференциацию
профиля по илу. Торфянисто-подзолистые почвы, формирующиеся на правобережье р. Оби (Кондаковское нефтяное месторождение), в значительной
мере обеднены илистой фракцией, и вследствие неоднородности почвообразующих пород содержание песчаных фракций в них значительно больше.
Длительное стояние высокорасположенных грунтовых вод и периодически
промывной водный режим значительно сокращают возможность вымывания продуктов подзолообразования, вследствие чего происходят замедление
проявления подзолистого процесса и сравнительно слабое перераспределение ила по профилю. Наблюдается утяжеление гранулометрического состава вниз по профилю торфянисто-глубокоподзолистых глеевых почв, что связано с накоплением пылеватых фракций и ила в иллювиальном горизонте и
материнской породе. Минеральная толща болотно-подзолистых и болотных
низинных почв претерпевает изменения под влиянием кислых растворов,
фильтрующихся из сфагновой залежи, грунтовых, болотно-грунтовых вод
или верховодки. В процессе естественной эволюции данных почв возрастает оглеение минеральной толщи, приводящее, в свою очередь, к диспергации минеральной массы почв [14].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
22
В.П. Середина, М.Е. Садыков, С.Л. Блохина
Таким образом, почвы подзолистого типа почвообразования (глееподзолистые, собственно подзолистые, болотно-подзолистые), являющиеся наиболее распространенными на исследуемой территории, отличаются слабо
выраженной дифференциацией илистой фракции по профилю, что находит
свое отражение в работах ряда авторов и объясняется литологической неоднородностью материнских пород. Следует отметить, что почвы правобережной части р. Оби (Кондаковское месторождение) имеют более легкий (супесчаный, песчаный) гранулометрический состав. Почвы, формирующиеся на
левобережье р. Оби (Аленкинское месторождение), характеризуются среднеи тяжелосуглинистым гранулометрическим составом. Изложенное выше позволяет заключить, что сочетание тяжелого гранулометрического состава и
повышенного содержания илистой фракции должно обеспечить более благоприятные и более устойчивые физические свойства почв, формирующихся в
пределах левобережья р. Оби (Аленкинский лицензионный блок).
Особенности структуры почвы и, следовательно, обусловленных ею
структурно-функциональных физических свойств в значительной степени определяются составом и свойствами элементарных почвенных частиц
и микроагрегатов. Элементарные почвенные частицы при определенных
условиях могут слипаться, склеиваться, свертываться (коагулировать), формируя микроагрегатный состав почв. По предложению К.К. Гедройца [15],
агрегаты диаметром менее 0,25 мм условно принято называть микроагрегатами. Именно у микроагрегатов появляется очень важное в агротехническом
и мелиоративном отношении свойство – дополнительная внутриагрегатная
пористость. В качестве интегральных показателей микроагрегированности
почв предложено несколько коэффициентов. Однако чаще всего используется фактор структурности (Кс) [7, 9]. Результаты микроагрегатного анализа
(рис. 1) указывают на то, что при всей неоднородности, связанной с различием состава почвообразующих пород, на разных типах геолого-геоморфологических поверхностей проявляются закономерности в профильном распределении, связанные с почвообразовательным процессом. Подзолообразование
как агрессивный относительно минерального каркаса процесс отличается
наиболее разрушительным действием, поэтому почвы подзолистого типа почвообразования характеризуются слабой микроагрегированностью, причем
элювиальные горизонты менее агрегированы по сравнению с иллювиальными. Так, в глееподзолистой обычной мелкой тяжелосуглинистой почве (разрез 106.06) горизонт А2 богат агрегатами размером более 0,05 мм (рис. 1),
а наибольшими значениями агрегированности, судя по фактору структурности, обладают иллювиальные горизонты (табл. 2). Глубокоподзолистая
обычная тяжелосуглинистая почва (разрез 100.06) в связи со значительным
содержанием физической глины (41,2–51,2%) обладает низкой микрооструктуренностью. Что касается подзолистых почв песчаного гранулометрического состава, то для них характерна очень слабая агрегированность, имеющая
по классификации Н.А. Качинского [9] неудовлетворительную оценку.
0,25–0,05 мм
0,05–0,01 мм
2
0,01–0,005 мм
3
0,005–0,001
мм
Рис. 1. Распределение фракций микроагрегатного состава исследуемых почв:
1 – глееподзолистая обычная мелкая тяжелосуглинистая почва, разрез 106.06; 2 – глубокоподзолистая обычная легкосуглинистая
почва, разрез 100.06; 3 – мелкоподзолистая иллювиально-железистая языковатая песчаная почва, разрез13/1-07
1–0,25 мм
1
<0,0
мм
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Физическое состояние фоновых почв
23
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
24
В.П. Середина, М.Е. Садыков, С.Л. Блохина
Почвенно-гидрологические показатели исследуемых почв
Та бл и ц а 2
Гидрологические константы, %
Глубина,
Кс
Кд
Кстр
см
МГ
ВЗ
НВ
ПВ
ДАВ
Глееподзолистая обычная мелкая тяжелосуглинистая почва, разрез 106.06
А0
0–3
–
–
–
–
–
A2g
3–10
6,7
9,1
34,7
63,8
25,6
83,6
16,4
1,3
A2g
13–23
6,3
8,5
31,1
59,6
22,6
86,4
13,6
0,8
A2Bg
30–40
6,4
8,7
25,0
50,7
16,3
86,1
13,9
1,3
B1g
65–75
6,8
9,2
23,9
52,0
14,7
87,0
13,0
0,7
BСFeg
130–140
7,0
9,5
27,7
59,4
18,2
87,3
12,7
0,3
Глубокоподзолистая обычная глинистая почва, разрез 100.06
А0
0–6
–
–
–
–
–
A1A2
6–16
7,1
9,6
33,3
58,7
23,7
85,7
14,3
0,7
A2
30–40
7,4
10,0
29,9
55,6
19,9
90,8
9,2
1,2
A2B
50–60
7,0
9,5
28,6
47,8
19,1
89,0
11,0
1,6
B1
70–80
7,8
10,5
31,5
50,8
21,1
91,5
8,5
1,6
B2
105–115
8,5
11,5
31,9
51,5
20,4
90,7
9,3
0,7
BC
145–155
6,6
9,0
31,9
52,1
22,9
89,4
10,6
0,2
Мелкоподзолистая иллювиально-железистая языковатая песчаная почва, разрез 13/1-07
А0
3–6
–
–
–
–
–
А2
6–13
0,6
0,9
–
44,1
–
77,3
22,7
0,1
А2Вfe
20–30
1,4
1,8
–
43,7
–
85,7
14,3
0,1
Вfe
60–70
1,2
1,6
–
34,3
–
97,1
2,9
0,1
ВСfe
100–110
0,9
1,2
–
24,5
–
85,7
14,3
0,1
Горизонт
Примечание. МГ – максимальная гигроскопичность; ВЗ – влажность завядания; НВ –
наименьшая влагоемкость; ПВ – полная влагоемкость; ДАВ – диапазон активной влаги;
Кс – фактор структурности по Фагелеру; Кстр – коэффициент структурности; Кд – фактор
дисперсности по Качинскому.
Агрегатный состав почвы оказывает существенное влияние на физические
условия почв, их водный, тепловой режимы и связанные с ними условия микробиологической деятельности. По мнению В.И. Савич [16], структурные отдельности почв являются матрицей, на которой протекают все физико-химические
процессы, развитие корневых систем растений, поглощение ими элементов питания. Структурный состав характеризует более высокий и сложный агрегатный уровень организации почв. Он является проявлением сущности протекающих в них процессов, критерием плодородия почв или их деградации.
Кроме того, агрегатный состав играет большую роль в формировании
фонда доступных для растений питательных веществ. Количественный и качественный состав макроструктурных отдельностей почвы в значительной
степени определяет также ее устойчивость к различного рода техногенным
нагрузкам. Исследования макроагрегатного состава почв указывают на то,
что макроструктура почв в значительной степени зависит от гранулометрического состава и гумусности. Существенную роль в образовании структурных
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Физическое состояние фоновых почв
25
агрегатов играют биологические агенты и в первую очередь корневые системы преимущественно травянистых растений, способствуя как механической
прочности агрегатов, так и водоустойчивости. В подзолистых и глееподзолистых почвах тяжелого гранулометрического состава содержание водопрочных
агрегатов колеблется от 30 до 40%. Коэффициент структурности данных почв
свидетельствует о хорошей водопрочности. Худшую структурность имеют
подзолистые почвы легкого гранулометрического состава.
Главными причинами низкого содержания в них водопрочных агрегатов
являются гранулометрический состав, незначительные запасы гумуса, выступающего в качестве клеящего вещества, его фульватный состав [17], а также
бедность органоминеральными коллоидами. В связи с этим песчаные подзолистые почвы не способны образовывать водопрочные агрегаты. Имея высокую
долю фракций песка в гранулометрическом составе, подзолистые почвы не обладают агрономически ценной водопрочной комковато-зернистой структурой,
а следовательно, неустойчивы и подвержены как эрозионным процессам, так
и техногенному воздействию, в частности загрязнению органическими поллютантами. Устойчивость структурного состояния почв к антропогенным воздействиям в работах В.Ф. Уткаевой [18] и И.В. Кузнецовой [19] рассматривается как способность противостоять внешнему воздействию до исходного или
близкого к нему уровня. Такая устойчивость реализуется за счет взаимодействия различных специфических почвенных механизмов и в большей степени
за счет способности почвенной массы к переагрегации, которая происходит в
результате циклов набухания-усадки при увлажнении и высыхании, замораживании и оттаивании, обработки почвы и воздействия биологических факторов.
В результате этих процессов идет формирование новых почвенных агрегатов и
порового пространства, т.е. иного структурного состояния.
Исследованные подзолистые почвы, особенно легкого гранулометрического состава, имеют низкое содержание агрономически ценных агрегатов,
отличаются неудовлетворительной оценкой и характеризуются как неустойчивые. Такое структурное состояние, по мнению П.Н. Березина и И.И. Гудима [20], является критическим. В подзолистых и глееподзолистых почвах,
представленных тяжелым (суглинистым и глинистым) гранулометрическим
составом, содержание водопрочных агрегатов (более 1 мм) колеблется от 30
до 40%. Коэффициент структурности данных почв свидетельствует об их
хорошей водопрочности.
Общая порозность поверхностных гумусовых горизонтов при достаточно
высокой плотности составляет не более 15%, что по классификации Н.А. Качинского соответствует чрезмерно низкой, характерной для иллювиальных
горизонтов [21]. Самая высокая порозность наблюдается в наименее уплотненных горизонтах, в частности А2, и колеблется в пределах 34–48% (рис. 2).
Особое значение при составлении количественных характеристик влагообеспеченности сельскохозяйственных культур имеют почвенно-гидрологические константы (см. табл. 2).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
В.П. Середина, М.Е. Садыков, С.Л. Блохина
26
%
а
%
б
Рис. 2. Общая порозность в профилях исследуемых почв:
а – глееподзолистая обычная мелкая тяжелосуглинистая почва (разрез 106.06);
б – глубокоподзолистая обычная глинистая почва (разрез 100.06)
Вследствие неоднородности почв исследуемой территории по гранулометрическому составу водно-физические свойства данных почв имеют существенные различия. Для песчаных и супесчаных разновидностей подзолистых почв характерны невысокие количественные показатели максимальной
гигроскопичности и влажности завядания, что указывает на незначительное
содержание влаги в почве в прочносвязанном состоянии. Следует также отметить малую изменчивость данных параметров по почвенному профилю.
В глееподзолистой и глубокоподзолистой почвах, имеющих более тяжелый
гранулометрический состав, показатели максимальной гигроскопичности и
влажности завядания резко возрастают, что объясняется значительно большим содержанием пылеватых, способных к адсорбции влаги частиц.
Диапазон активной влаги и наименьшая влагоемкость – две взаимозависящие гидрологические константы, в профилях почв с тяжелым гранулометрическим составом уменьшаются с глубиной. Максимальные значения
данных параметров наблюдаются в поверхностных элювиальных горизонтах, что по классификации Н.А. Качинского соответствует хорошей оценке
при выращивании сельскохозяйственных культур.
Как указывается в работе М.М. Ландиной [22], повышенная уплотненность и низкое содержание крупных, свободных от воды пор в иллювиальных и нижерасположенных горизонтах подзолистых почв обусловливают
пониженную водоотдачу и водопроницаемость этих горизонтов, в то время
как поверхностные элювиальные горизонты – высокопроницаемы. Таким
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Физическое состояние фоновых почв
27
образом, в целом водопроницаемость верхней части профиля исследуемых
подзолистых почв можно оценить как высокую, обеспечивающую быстрое
впитывание талых вод и выпадающих жидких осадков. Резко сниженную
водопроницаемость в иллювиальном горизонте (обладающем рядом других
неблагоприятных свойств) следует рассматривать как отрицательное свойство: при значительном объеме поступивших в почву вод она способствует
формированию горизонта временной верховодки в почвенном профиле, что
может вызвать усиление процессов оглеения.
Заключение
Устойчивость физических свойств почв к естественным и антропогенным
воздействиям – это их способность сохранять, в первую очередь, структурное
состояние и сложение как интегральные показатели физического состояния
почв [19]. Следовательно, за эталон устойчивости в конкретной геохимической обстановке ландшафта можно принять целинные (фоновые) почвы, обладающие характерными параметрами, присущими только для данного генетического типа почв. Основными параметрами физического состояния почв, от
которых зависит структурное состояние и сложение, а следовательно, и устойчивость почв к различного рода антропогенным нагрузкам, является, прежде
всего, гранулометрический состав, в частности содержание илистой фракции.
Почвы подзолистого типа почвообразования (глееподзолистые, собственно
подзолистые, болотно-подзолистые), являющиеся наиболее распространенными на исследуемой территории, отличаются слабо выраженной дифференциацией илистой фракции по профилю, что находит свое подтверждение в работах
ряда авторов и объясняется литологической неоднородностью материнских пород. Следует отметить, что почвы правобережной части р. Оби (Кондаковское
месторождение) имеют более легкий (супесчаный, песчаный) гранулометрический состав. Имея высокую долю фракций песка в гранулометрическом составе при одновременной обедненности минеральными коллоидами, эти почвы не
обладают агрономически ценной водопрочной структурой, а следовательно, в
большей степени подвержены процессам эрозии и техногенному воздействию.
Почвы, формирующиеся на левобережье р. Оби (Аленкинское месторождение),
характеризуются средне- и тяжелосуглинистым гранулометрическим составом.
Сочетание тяжелого гранулометрического состава и повышенного содержания
илистой фракции должно обеспечить и более устойчивые физические свойства
формирующихся здесь почв. Однако данные почвы в целом характеризуются повышенной уплотненностью и низким содержанием крупных, свободных от воды
пор, что обусловливает их слабую дренирующую способность. В работах [23, 24]
нами показано, что разрабатываемые нефтяные месторождения представляют потенциальную угрозу загрязнения почв не только нефтью, но и сопутствующими
высокоминерализованными водами, и опасность загрязнения нефтяными компонентами зависит в значительной степени от положения данных почв в системе
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
28
В.П. Середина, М.Е. Садыков, С.Л. Блохина
геохимически сопряженных ландшафтов. Проведенные исследования позволяют
считать, что определяющую роль при этом будут играть отдельные параметры
физического состояния почв, и прежде всего гранулометрический состав.
Литература
1. Середина В.П., Андреева Т.А., Алексеева Т.П. и др. Нефтезагрязненные почвы: свойства
и рекультивация. Томск : Изд-во ТПУ, 2006. 270 с.
2. Пиковский Ю.И. Природные и техногенные потоки углеводородов в окружающей среде. М. : Изд-во МГУ, 1993. 208 с.
3. Солнцева Н.П. Добыча нефти и геохимия природных ландшафтов. М. : Изд-во МГУ,
1998. 376 с.
4. Классификация и диагностика почв России. Смоленск : Ойкумена, 2004. 342 с.
5. Классификация и диагностика почв СССР. М. : Колос, 1977. 225 с.
6. Классификация и диагностика почв Западной Сибири. Новосибирск : Институт Запгипрозем, 1979. 47 с.
7. Вадюнина А.Ф. Методы исследования физических свойств почв. М. : Агропромиздат,
1986. 416 с.
8. Воронин А.Д. Основы физики почв. М. : Изд-во МГУ, 1986. 244 с.
9. Качинский Н.А. Механический и микроагрегатный состав почвы, методы изучения.
М. : Изд-во АНСССР, 1958. 235 с.
10. Шоба С.А. Морфология и морфогенез почв // Структурно-функциональная роль почвы в биосфере. М. : Геос, 1999. С. 20–29.
11. Дюкарев А.Г. Ландшафтно-динамические аспекты таежного почвообразования в Западной Сибири. Томск : Изд-во НТЛ, 2005. 284 с.
12. Гаджиев И.М., Курачев В.М. Специфика почвообразования и некоторые итоги исследований // Генезис, эволюция и география почв Западной Сибири. Новосибирск :
Наука, 1988. С. 5–14.
13. Дюкарев А.Г. Особенности почвообразования в таежной зоне Западной Сибири // Современные проблемы почвоведения в Сибири : материалы Междунар. конф. Томск :
Изд-во ТГУ, 2000. Т. 1. С. 166–169.
14. Караваева Н.А. Заболачивание и эволюция почв. М. : Наука, 1982. 296 с.
15. Гедройц К.К. К вопросу о почвенной структуре и сельскохозяйственном ее значении
// Избранные сочинения. М., 1955. Т. 1. С. 407–419.
16. Савич В.И., Байбеков Р.Ф., Банников В.Н. Физические свойства почв как матрица их плодородия // Устойчивость почв к естественным и антропогенным воздействиям. М., 2002. С. 85.
17. Блохина С.Л., Середина В.П. Гумусное состояние фоновых почв Кондаковского месторождения углеводородного сырья // Вестник Томского государственного университета. Биология. 2009. №. 1. С. 44–51.
18. Уткаева В.Ф. Устойчивость структурного состояния почв к антропогенным воздействиям // Устойчивость почв к естественным и антропогенным воздействиям. М., 2002. С. 15.
19. Кузнецова И.В. Устойчивость физических свойств почв разного генезиса к естественным и антропогенным воздействиям // Устойчивость почв к естественным и антропогенным воздействиям. М., 2002. С. 107–108.
20. Березин П.Н., Гудима И.И. Физическая деградация почвы: параметры состояния //
Почвоведение. 1994. № 11. С. 67–70.
21. Шеин Е.В., Гончаров В.М. Агрофизика. Ростов н/Д : Феникс, 2006. 400 с.
22. Ландина М.М. Агрофизическая характеристика почв Западной Сибири // Агрофизическая характеристика почв нечерноземной зоны Азиатской части СССР. М. : Колос,
1978. С. 21–89.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Физическое состояние фоновых почв
29
23. Середина В.П., Непотребный А.И., Садыков М.Е. Характер изменения свойств почв
нефтезагрязненных экосистем в условиях гумидного почвообразования // Вестник
КрасГАУ. 2010. № 10. С. 49–54.
24. Середина В.П., Непотребный А.И. Прогнозно-эволюционные аспекты посттехногенных трансформаций почв нефтезагрязненных экосистем южной тайги Западной
Сибири // Эволюция почвенного покрова. История идей и методы, голоценовая эволюция, прогнозы / отв. ред. И.В. Иванов, Л.С. Песочина. Пущино, 2009. С. 292–293.
Поступила в редакцию 15.05.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 17–29.
Valentina P. Seredina1, Marat E. Sadikov2, Svetlana V. Blokhina
1
Biological Institute of Tomsk State University, Tomsk, Russia
Tomsk Oil and Gas Research and Design Institute (OAO TomskNIPIoil), Tomsk, Russia
2
PHYSICAL STATE OF BACKGROUND SOILS OF OIL FIELDS
OF THE MIDDLE TAIGA OF WESTEN SIBERIA
The resistance of physical properties to natural and anthropogenic influences is
their ability to save the structural state and composition, as an integral indicator of
the physical condition of the soil. Consequently, the standard for sustainability in a
specific geochemical environment of the landscape can take undisturbed (background)
soil, having the characteristic parameters, inherent to a given genetic type of soil. Soils
of podzolic type soil (gleepodzolistye actually podzolic, bog-podzolic), which are the
most common in the study area of oil fields, differ by pronounced differentiation of
clay fraction by the profile, which has been affirmed by several authors and is due
to lithologic heterogeneity of the parent rocks. Most clearly differentiated particle
size distribution of the eluvial-illuvial type is characteristic of podzolic soils, which is
reflected in the structure of the illuvial horizon, the upper part of which is characterized
by a rather pronounced signs of illuviation (structure, adding more dense).
It should be noted that the right bank of the Ob river soil (Kondakovskoye mine) has
a lighter (loamy, sand) grain size. With a high proportion of sand fractions in the grain
composition with simultaneous depletion of mineral colloids, these soils do not possess
agronomically valuable water-stable structure, and, therefore, are more susceptible
to erosion and anthropogenic impacts. Soils formed on the left bank of The Ob river
(Alenkinskoe deposit), is characterized by medium-and heavy-grading. The combination
of heavy granulometric composition and high content of clay fraction should provide
more stable and physical properties of soils formed here. Сreating and maintaining the
necessary level of fertility, in particular, the availability of moisture, heat, and major
elements of mineral nutrition of plants depend not only on particle size, but also on a
complex of other physical properties, which should ensure sustainability of the soil not
only with biogeocenotic positions, but also as an object of anthropogenic influences.
However, the evidence of soil compaction is generally characterized by high and
low content of large-free waters, which gives them poor drainage capacity. Developed
oil fields are a potential threat to soil contamination, not only with oil but also with
highly mineralized water and the risk of pollution by oil components depends largely
on the position of these soils in the geochemically associated landscapes. Our studies
show that certain parameters of the physical condition of soil play a determining role,
and above all, the size distribution.
Key words: background soils in Western Siberia; middle taiga; oil fields; the
physical properties; landscape; sustainability.
Received May 15, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 30–42
БОТАНИКА
УДК 581.332+582.323(1-925.11)
Л.Г. Бабешина1, А.A. Кузнецов2
1
Сибирский государственный медицинский университет (г. Томск)
Биологический институт Томского государственного университета (г. Томск)
2
МОРФОЛОГИЯ СПОР И СПОРОГОНОВ НЕКОТОРЫХ ВИДОВ
СФАГНОВЫХ МХОВ, ВСТРЕЧАЮЩИХСЯ НА ТЕРРИТОРИИ
ЗАПАДНО-СИБИРСКОЙ РАВНИНЫ
Работа выполнена при финансовой поддержке РФФИ (грант № 10-04-00637-а).
Приведены описания и анализ морфологии спор и спорогонов у видов рода
Sphagnum L. секций Insulosa Isov., Rigida (Lindb.) Schlieph., Sphagnum (Palustria
C. Jens.) и Squarrosa (Russ.) Schimp., произрастающих на территории Западно-Сибирской равнины. Споры исследованных видов относятся к средним (20–
25 мкм): S. aongstroemii, S. magellanicum, S. palustre, S. squarrosum и крупным
(> 25 мкм): S. compactum, S. papillosum. Экваториальная складка, более или менее четко выраженная у представителей секций Rigida, Squarrosa и Sphagnum,
у вида секции Insulosa не выявлена. По характеру скульптуры экзоспория споры
у видов секций Sphagnum и Squarrosa – папиллозные, секций Insulosa и Rigida –
папилозно-бугорчатые. Поверхность экзоспория со слабовыраженной зернистостью отмечена у S. aongstroemii, S. magellanicum, S. palustre, S. squarrosum,
S. papillosum и с четко выраженной зернистостью – у S. compactum. Зрелые спорогоны исследованных видов коричневого или темно-коричневого цвета. Споры
S. aongstroemii и S. palustre желтого цвета, у остальных видов – рыжие или с
рыжеватым оттенком.
Ключевые слова: споры; сфагновые мхи; морфология; Западно-Сибирская
равнина.
Введение
Этой статьей мы завершаем цикл публикаций, посвященных изучению
морфологии спор и спорогонов у видов рода Sphagnum L., произрастающих на Западно-Сибирской равнине. Ранее были опубликованы сведения о
наиболее представительных по числу видов секциях Cuspidata и Acutifolia
[2, 3]. В этой статье речь пойдет о секциях Insulosa Isov., Rigida (Lindb.)
Schlieph, Squarrosa (Russ.) Schimp. и Sphagnum (Palustria C. Jens.). Первые
две секции монотипны и представлены S. aongstroemii и S. compactum соответственно. Squarrosa включает два вида: S. squarrosum и S. teres, а секция
Sphagnum объединяет четыре вида: S. magellanicum, S. centrale, S. palustre и
S. papillosum. Наиболее широко распространены S. magellanicum, S. centrale
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Морфология спор и спорогонов некоторых видов
31
и S. squarrosum [5]. Спорадически по всей территории исследований встречаются S. papillosum и S. compactum. Изредка, преимущественно на севере, встречается S. aongstroemii, единично на юге – S. palustre. По данным
литературы [10], в европейских условиях однодомные сфагновые мхи образуют спорогоны часто, а двудомные – редко или случайно. S. squarrosum
и S. compactum являются однодомными растениями, они часто образуют
спорогоны на территории средней части европейской России, тогда как
остальные виды двудомные и спороношение у них наблюдается редко, а у
S. aongstroemii вообще не было зафиксировано [7, 9]. В условиях болотных
сообществ Западно-Сибирской равнины спорогоны чаще всего формируют
S. squarrosum, S. magellanicum и S. papillosum (июль – август).
Споры сфагновых мхов шаровидно-тетраэдрической формы с трехлучевой щелью (лезурой) на внутренней (проксимальной) стороне споры. Наружная (дистальная) поверхность – выпуклая. Оболочка споры двойная, состоящая из кутинизированного, желтоватого внешнего слоя (экзоспория) и
внутреннего, бесцветного, целлюлозного (эндоспория). Экзоспорий, более
или менее окрашенный в различные оттенки желтого или бурого цвета [1,
9], является носителем различного рода скульптуры и капелек масла разного
диаметра [6]. Споры бывают гладкие или зернистые, бородавчатые до папиллозных [8].
Цель настоящей работы – уточнение морфологических характеристик и
выявление диагностических признаков спор сфагновых мхов секций Insulosa, Rigida, Squarrosa и Sphagnum, встречающихся на территории ЗападноСибирской равнины.
Материалы и методики исследования
Объектами исследования были споры 6 видов: Sphagnum aongstroemii
Hartm., S. compactum Lam. & DC., S. magellanicum Brid., S. palustre L., S. papillosum Lindb. и S. squarrosum Crome. Споры S. centrale C. Jens. и S. teres
(Schimp.) Ångstr. нам не удалось исследовать в силу отсутствия среди находок в природе и в гербарных коллекциях экземпляров со спорогонами.
Споры исследовали на растровом электронном микроскопе Philips SEM
515 (Philips, Голландия). Образцы спор фиксировали на двустороннем канцелярском скотче. Для уменьшения влияния заряда их напыляли серебром
методом термического напыления в вакууме. Споры исследовали в режиме
высокого вакуума, поверхность образцов сканировали при ускоряющем напряжении 15–30 кВ. Диагностирование размера, формы и характера морфологии поверхности спор проводили при увеличении в 3 000–20 000 раз.
Ниже приводятся описания и оригинальные микрофотографии спор
6 видов Sphagnum, исследованных с использованием метода растровой электронной микроскопии.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
32
Л.Г. Бабешина, А.А. Кузнецов
Результаты исследования и обсуждение
Секция Insulosa Isov.
S. aongstroemii Hartm. – С. Онгстрема (рис. 1, а–е; таблица).
Очертание спор в проксимально- и дистально-полярном положениях
округло-треугольное или почти округлое. Экваториальный диаметр 21–
27 мкм. Экваториальная складка отсутствует. Лучи лезуры тонкие, равномерно утолщенные. Характер скульптуры экзоспория на проксимальной
и дистальной сторонах споры папиллозно-бугорчатый, на проксимальной
стороне – тонко-складчатый с разной степенью выраженности. Радиальносимметричные борозды на дистальной стороне споры отсутствуют. Поверхность экзоспория с нечетко выраженной зернистостью и многочисленными
мелкими капельками масла.
И с с л е д о в а н н ы й о б р а з е ц № 7’;7 : Ямало-Ненецкий автономный
округ, исток р. Король-яха-тарка, граница тундры и лесотундры, шейхцериево-осоково-сфагновая топь. 13.08.2005 г. Л.Г. Бабешина; Ямало-Ненецкий
автономный округ, 40 км. трассы Ямбург – Новый Уренгой, осоково-сфагновая топь. 15.08.2005 г. Л.Г. Бабешина.
Секция Rigida (Lindb.) Schlieph.
S. compactum Lam. & DC. – С. компактный (рис. 2, а–е; таблица).
Очертание спор в проксимально- и дистально-полярном положениях
округло-треугольное или почти округлое. Экваториальный диаметр 25–
28 мкм. Экваториальная складка четко выраженная. Лучи лезуры равномерно утолщенные по всей длине или слегка сужающиеся к периферии. Характер скульптуры экзоспория на дистальной стороне споры бугорчатый,
варьирующий от мелкопапиллозного до крупнопапиллозного, на проксимальной стороне – мелкопапиллозный, радиально тонко-складчатый. Радиально-симметричные борозды на дистальной стороне споры могут быть
четко или нечетко выраженными, редко отсутствуют. Поверхность экзоспория четко выраженная, крупнозернистая, покрыта многочисленными капельками масла.
И с с л е д о в а н н ы й о б р а з е ц № 1 3 : Ханты-Мансийский автономный округ, болото Кукушкино, в понижениях низкой гряды, около озера.
03.08.2005 г. Л.Г. Бабешина.
Секция Sphagnum (Palustria C. Jens.)
S. magellanicum Brid. – С. магелланский (рис. 3, а–е; таблица).
Очертание спор в проксимально- и дистально-полярном положениях
округло-треугольное. Экваториальный диаметр 20–25 мкм. Экваториальная складка более или менее четко выраженная. Лучи лезуры равномерно
утолщенные по всей длине или слегка сужающиеся к периферии. Скульптура экзоспория на дистальной и проксимальной сторонах споры характеризуется наличием крупных, округлых, редко неправильной формы, четко
разграниченных между собой папилл, равномерно расположенных по всей
д
г
е
в
Рис. 1. Микрофотографии спор S. aongstroemii: а, б – проксимальная сторона споры; г, д – дистальная сторона споры;
в – увеличенный фрагмент проксимальной стороны споры; е – увеличенный фрагмент дистальной стороны споры
б
а
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Морфология спор и спорогонов некоторых видов
33
д
г
е
в
Рис. 2. Микрофотографии спор S. compactum: а, б – проксимальная сторона споры; г, д – дистальная сторона споры;
в – увеличенный фрагмент проксимальной стороны споры; е – увеличенный фрагмент дистальной стороны споры
б
34
а
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Л.Г. Бабешина, А.А. Кузнецов
д
г
е
в
Морфология спор и спорогонов некоторых видов
Рис. 3. Микрофотографии спор S. magellanicum: а, б – проксимальная сторона споры; г, д – дистальная сторона споры;
в – увеличенный фрагмент проксимальной стороны споры; е – увеличенный фрагмент дистальной стороны споры
б
а
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
35
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
36
Л.Г. Бабешина, А.А. Кузнецов
поверхности. Радиально-симметричные борозды на дистальной стороне
споры четко выражены. Поверхность экзоспория со слабо выраженной или
отсутствующей зернистостью и фрагментарными капельками масла.
Морфологические характеристики спорогонов и спор видов р. Sphagnum
Окраска и
Диаметр спор, мкм
Цвет спор
по Игнатову,
диаметр
2003;
по СавичВиды
спорогона, мм
данные
данные
по СавичЛюбицкой,
Sphagnum
(данные авторов
авторов
авторов
Любицкой,
1968
по гербарным
1968
образцам)
Секция Insulosa Isov.
Коричневый
Желтоватооколо 25/22–30 21–27
Желтые
S. aongstroemii
1,5–2,0
бурые
Секция Rigida (Lindb.) Schlieph.
РыжеватоЧерноЖелтовато- коричневые
коричневый
28–32/26–33
25–28
S. compactum
бурые
или светло1,0–1,5
коричневые
Секция Sphagnum (Palustria C. Jens.)
ТемноЖелтоватоСветлокоричневый
25–30/25–30
20–25
S. magellanicum
бурые
желтые
(1,0)1,5–2,0
Темнокоричневый
25–29/28–33
22–27 Желтоватые
Желтые
S. palustre
(2,0)2,5–3,0
Коричневый
29–32/26–36
24–30 Желтоватые
Рыжие
S. papillosum
1,5–2,3(2,5)
Секция Squarrosa (Russ.) Schimp.
ТемноРыжеватоБуроватокоричневый
21–30/21–30
19–23
коричневые
S. squarrosum
желтые
2,0–3,0
или рыжие
И с с л е д о в а н н ы й о б р а з е ц № 1 9 : Томская область, Томский
район, 86-й квартал, Кирсановское болото, сосново-кустарничково-сфагновое сообщество. 03.08.2008 г. Л.Г. Бабешина.
S. palustre L. – С. болотный (рис. 4, а–е; таблица).
Очертание спор в проксимально- и дистально-полярном положениях
округло-треугольное. Экваториальный диаметр 22–27 мкм. Экваториальная складка более или менее четко выраженная. Лучи лезуры равномерно
утолщенные по всей длине или слегка сужающиеся к периферии. Характер скульптуры экзоспория на дистальной и проксимальной сторонах споры папиллозный, на проксимальной – тонко-складчатый с разной степенью
выраженности. Радиально-симметричные борозды на дистальной стороне
споры четко выражены. Поверхность экзоспория со слабо выраженной или
отсутствующей зернистостью и фрагментарными или единичными капельками масла.
д
г
е
в
Рис. 4. Микрофотографии спор S. palustre: а, б – проксимальная сторона споры; г, д – дистальная сторона споры;
в – увеличенный фрагмент проксимальной стороны споры; е – увеличенный фрагмент дистальной стороны споры
б
а
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Морфология спор и спорогонов некоторых видов
37
д
г
е
в
Рис. 5. Микрофотографии спор S. papillosum: а, б – проксимальная сторона споры; д – дистальная сторона споры;
в, г – увеличенные фрагменты проксимальной стороны споры; е – увеличенный фрагмент дистальной стороны споры
б
38
а
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Л.Г. Бабешина, А.А. Кузнецов
д
г
е
в
Морфология спор и спорогонов некоторых видов
Рис. 6. Микрофотографии спор S. squarrosum: а, б – проксимальная сторона споры; д – дистальная сторона споры;
в, г – увеличенные фрагменты проксимальной стороны споры; е – увеличенный фрагмент дистальной стороны споры
б
а
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
39
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
40
Л.Г. Бабешина, А.А. Кузнецов
И с с л е д о в а н н ы й о б р а з е ц № 2 1 : Томская область, окр. д. Победа, окраина рослого ряма, сосново-кустарничково-травяно-сфагновое сообщество. 07.07.2009 г. Л.Г. Бабешина.
S. papillosum Lindb. – С. папиллозный (рис. 5, а–е; таблица).
Очертание спор в проксимально- и дистально-полярном положениях
округло-треугольное. Экваториальный диаметр 24–30 мкм. Экваториальная складка более или менее четко выраженная. Лучи лезуры равномерно
утолщенные по всей длине или слегка сужающиеся к периферии. Характер
скульптуры экзоспория на дистальной и проксимальной сторонах споры
папиллозный. На проксимальной стороне папиллы асимметричные, крупные, нередко сливающиеся между собой, на дистальной – почти округлой
формы. Радиально симметричные борозды на дистальной стороне споры
нечетко выражены. Поверхность экзоспория со слабо выраженной или отсутствующей зернистостью и фрагментарными капельками масла.
И с с л е д о в а н н ы й о б р а з е ц № 3 : Томская область, Бакчарский
район, окр. пос. Плотниково, Бакчарское болото, осоково-шейхцериевая топь
грядово-мочажинно-озеркового комплекса. 23.07.2005 г. Л.Г. Бабешина.
Секция Squarrosa (Russ.) Schimp.
S. squarrosum Crome. – С. оттопыренный (рис. 6, а–е; таблица).
Очертание спор в проксимально- и дистально-полярном положениях
округло-треугольное. Экваториальный диаметр 19–23 мкм. Экваториальная
складка четко выраженная. Лучи лезуры равномерно утолщенные по всей
длине или сужающиеся к периферии. Характер скульптуры экзоспория на
дистальной и проксимальной сторонах споры папиллозный, папиллы асимметричные, крупные, нередко сливающиеся между собой. Радиально симметричные борозды на дистальной стороне споры не выраженные. Поверхность экзоспория со слабо выраженной или отсутствующей зернистостью и
многочисленными крупными капельками масла.
И с с л е д о в а н н ы й о б р а з е ц № 6 : Томская область, Бакчарский
район, окр. пос. Плотниково, Бакчарское болото, тростниково-вейниковоосоково-сфагновое сообщество. 23.07.2005 г. Л.Г. Бабешина.
Заключение
Согласно общепринятой классификации по величине [4], споры исследованных видов можно отнести к двум категориям: средние (20–25 мкм),
характерные для S. aongstroemii, S. magellanicum, S. palustre, S. squarrosum,
и крупные (> 25 мкм) у S. compactum и S. papillosum. Экваториальная складка, более или менее четко выраженная у представителей секций Rigida,
Squarrosa и Sphagnum, у вида секции Insulosa не выявлена. По характеру
скульптуры экзоспория споры у видов секций Sphagnum и Squarrosa – папиллозные, секций Insulosa и Rigida – папилозно-бугорчатые. Поверхность
экзоспория со слабовыраженной зернистостью отмечена у S. aongstroemii,
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Морфология спор и спорогонов некоторых видов
41
S. magellanicum, S. palustre, S. squarrosum, S. papillosum и с четко выраженной зернистостью – у S. compactum. Зрелые спорогоны исследованных
видов коричневого или темно-коричневого цвета. Споры S. aongstroemii и
S. palustre желтого цвета, у остальных исследованных видов – рыжие или с
рыжеватым оттенком.
За предоставленную возможность проведения исследований на сканирующем электронном микроскопе авторы выражают благодарность директору Томского материаловедческого центра коллективного пользования
при Томском государственном университете В.М. Кузнецову.
Литература
1. Абрамова А.Л., Савич-Любицкая Л.И., Смирнова З.Н. Определитель листостебельных
мхов Арктики СССР. М. ; Л. : Изд-во АН СССР, 1961. 714 с.
2. Бабешина Л.Г., Кузнецов А.А. Морфология спор и спорогонов сфагновых мхов секции
Cuspidata (Lindb.) Schlieph. Западной Сибири // Вестник Томского государственного
университета. Биология. 2010. № 3(11). С. 5–12.
3. Бабешина Л.Г., Кузнецов А.А. Морфология спор и спорогонов сфагновых мхов секции
Acutifolia Wils. Западной Сибири // Вестник Томского государственного университета. Биология. 2010. № 4(12). С. 44–50.
4. Бобров А.Е., Куприянова Л.А., Литвинцева М.В., Тарасевич В.Ф. Споры папоротникообразных и пыльца голосеменных и однодольных растений флоры европейской части
СССР. Л. : Наука, 1983. 208 с.
5. Зверев А.А., Бабешина Л.Г. Оценка условий местообитаний сфагновых мхов Западно-Сибирской равнины по ведущим экологическим факторам: объекты, материалы
и методические основы // Вестник Томского государственного университета. 2009.
№ 325. С. 167–173.
6. Домбровская А.В., Коренева М.М., Тюремнов С.Н. Атлас растительных остатков, встречаемых в торфе. М. ; Л. : Госэнергоиздат, 1959. 90 с.
7. Игнатов М.С., Игнатова Е.А. Флора мхов средней части европейской России : в 2 т.
Sphagnaceae–Hedwigiaceae. М. : Изд-во КМК, 2003. Т. 1. 608 с.
8. Савич-Любицкая Л.И. Флора споровых растений СССР. М.: Изд-во АН СССР, 1952.
С. 97–109.
9. Савич-Любицкая Л.И., Смирнова З.Н. Определитель сфагновых мхов СССР. Л. : Наука,
1968. 112 с.
10. Hill M.O. Shpagnopsida // The moss flora of Britain and Ireland. Cambridge. 1978. P. 30–86.
Поступила в редакцию 15.02.2011 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
42
Л.Г. Бабешина, А.А. Кузнецов
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 30–42
Larisa G. Babeshina¹, Alexander A. Kuznetsov²
¹Siberian State Medical University, Tomsk, Russia
²Biological Institute of Tomsk State University, Tomsk, Russia
MORPHOLOGY OF SPORES AND MOSS-CAPSULES OF SOME SPECIES
OF SPHAGNOUS MOSSES FOUND ON THE TERRITORY
OF WEST-SIBERIAN PLAIN
The article gives a description and analysis of both spores and moss-capsules
morphology mosses of the sections Insulosa Isov., Rigida (Lindb.) Schlieph., Sphagnum
(Palustria C. Jens.) and Squarrosa (Russ.) Schimp. of the genus Sphagnum L., found
on the territory of the West-Siberian plain. Investigations into the spore morphology
were carried out with the SEM-method. The spores of the investigated species are
applied to middle ones (20–25 mcm): S. aongstroemii, S. magellanicum, S. palustre,
S. squarrosum and big ones (> 25 mcm): S. compactum, S. papillosum. ‘The equatorial
fold is more or less clearly expressed in representatives of the section Rigida, Squarrosa
and Sphagnum, in the species of the section Insulosa – it is not revealed. According
to the character of exosporium sculpture in species of the sections Sphagnum and
Squarrosa – they are papillous, in species of the sections Insulosa and Rigida –
papillous-knobby. The surface of the exosporium with weakly expressed granularity is
marked in S. aongstroemii, S. magellanicum, S. palustre, S. squarrosu, S. papillosum
and with clearly expressed granularity – in S. compactum. The ripe moss-capsules of
the species under investigation are of brown and dark-brown colour. The spores of
S. aongstroemii and S. palustre are yellow, in other species red or with red tinge.
Key words: spores; sphagnous mosses; morphology; West-Siberian plain.
Received February 15, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 43–54
УДК 582(571.122)
Р.Х. Бордей1, Л.Ф. Шепелева2
Научно-исследовательский институт экологии и природопользования Севера
Сургутского государственного университета (г. Сургут, Ханты-Мансийский
автономный округ – Югра)
2
Сургутский государственный университет (г. Сургут, Ханты-Мансийский
автономный округ – Югра)
1
ХАРАКТЕРИСТИКА ФЛОРЫ г. СУРГУТА
Изучено современное состояние флоры г. Сургута, проведена инвентаризация флоры в пределах административной границы города. Выявлены и проанализированы таксономическая, биоморфологическая, экологическая и географическая структуры флоры на исследуемой территории. Проведено сравнение
по десяти ведущим семействам флор городов Западной Сибири (Сургут, Томск,
Тюмень). Выявлены некоторые особенности формирования флоры Сургута, связанные с молодостью города и суровыми природными условиями.
Ключевые слова: Сургут; флора города; сравнительный анализ флоры.
Введение
Изучение растительного покрова городов – проблема, которая привлекает к себе большое внимание. Город как экосистема включает в себя целый ряд техногенных местообитаний, коренным образом отличающихся
от условий произрастания зональных типов растительности, поэтому в
нем формируются специфические растительные сообщества со своеобразным видовым составом [1]. В настоящее время в таких сибирских городах,
как Омск, Томск, Новосибирск, Тюмень, городская флора изучена довольно хорошо. В Ханты-Мансийском автономном округе сведения об исследованиях городских флор появились сравнительно недавно, и имеющиеся
публикации содержат обрывочную или неполную информацию о флоре
городов [2–4].
Сургут – молодой и перспективный в своем развитии город Западной Сибири, крупнейший промышленный и культурный центр Ханты-Мансийского автономного округа, в котором ранее подобные исследования не проводились. Город расположен в центре Западно-Сибирской равнины на правом
берегу р. Оби, в подзоне средней тайги лесной зоны. Площадь города около
210 км2, население – свыше 300 тыс. человек. На данный момент это довольно молодая и динамично развивающаяся городская среда. Процесс формирования растительности значительно отличается от аналогичных процессов в
других городах, поскольку территория характеризуется достаточно суровыми климатическими условиями, что влияет на формирование растительного
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
44
Р.Х. Бордей, Л.Ф. Шепелева
покрова и состав фитоценозов. Свой вклад вносят также беспорядочная застройка города, большие площади промышленных зон, нарушенных экотопов и техногенных пустырей. Невозможно вычленить «старый» и «новый»
город (многие работы по анализу городской флоры используют именно этот
принцип – сравнение видового состава в исторических зонах города).
Цель данной работы – изучить флористическое разнообразие территории
г. Сургута в его административных границах.
Материалы и методики исследования
Объектом исследования является флора г. Сургута, которая объединяет
совокупность всех видов сосудистых растений данной местности за исключением культивируемых растений, не имеющих самостоятельного возобновления в условиях города. Флористические исследования, сбор и обработка материалов проводились в период 2002–2010 гг. Инвентаризация
флоры проведена в пределах административных границ города. При описании растительного покрова местности использовались стандартные геоботанические методы [5]. Исследования велись маршрутным способом. При
этом была изучена флора всех основных типов местообитаний г. Сургута,
как естественных, так и антропогенных. Параллельно производились сбор
и определение гербарного материала, при определении видов растений использовали «Флору Сибири» [6]. Анализ флоры проведен на основе общепринятых методик [7–12]. Номенклатура растений приведена в соответствии
с современными требованиями [13].
Результаты исследования и обсуждение
Собранный материал позволил выполнить флористический анализ растительности, который включает таксономический, биоморфологический,
экологический и географический анализ.
Таксономическая структура флоры Сургута
В результате наших исследований установлено, что флора г. Сургута
насчитывает 367 видов сосудистых растений, относящихся к 220 родам и
67 семействам. На изучаемой территории города выявлены ведущие семейства по количеству видов и родов растений, которые составляют ядро флоры
(табл. 1).
Из выявленных семейств наиболее крупными оказались Asteraceae,
Poaceae и Cyperacea, доля которых составляет 30% от всего количества выявленных видов растений. Эти семейства практически повсеместно присутствуют в первой триаде семейственно-видового спектра Голарктического
царства [8].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Характеристика флоры г. Сургута
45
Более конкретный вид изучаемой флоры можно просмотреть, расположив
слагающие флору роды по порядку убывания численности видов (табл. 2).
Таблица 1
Ведущие семейства флоры г. Сургута
Кол-во родов
№
Семейство
1
Asteraceae
2
Poaceae
3
Cyperaceae
4
Rosaceae
5
Fabaceae
6–7
Brassicaceae
6–7
Caryophyllaceae
8
Ranunculaceae
9–10
Polygonaceae
9–10
Salicaceae
Итого по 10 ведущим
семействам
абс.
% от общего
кол-ва родов
30
25
4
11
8
14
11
7
4
2
13,6
11,3
1,8
5,0
3,6
6,3
5
3,2
1,8
0,9
Кол-во видов
% от
общего
абс.
кол-ва
видов
48
13,0
39
10,6
23
6,3
20
5,4
19
5,2
18
4,9
18
4,9
14
3,8
12
3,3
12
3,3
116
52,5
223
Ведущие роды флоры г. Сургута
№
Род
Кол-во видов
1
2
3–4
3–4
5–8
5–8
5–8
5–8
9–12
9–12
9–12
9–12
Carex
Salix
Ranunculus
Rumex
Artemisia
Equisetum
Potentilla
Amoria
Juncus
Eriophorum
Poa
Pyrola
15
10
7
7
6
6
6
6
5
5
5
5
60,6
Таблица 2
% от общего кол-ва
видов
4,1
2,7
1,9
1,9
1,6
1,6
1,6
1,6
1,4
1,4
1,4
1,4
Ведущими по количеству видов во флоре г. Сургута являются роды Carex
и Salix. В родовых спектрах Арктики и Сибири роду Carex принадлежит
первое место [14], что еще раз подчеркивает бореальные черты флоры.
Большая численность видов этого рода, по-видимому, связана с развитой
речной сетью в пределах городской территории (рр. Обь, Сайма, Кривуля.
Бардыковка, Черная, крупное водохранилище ГРЭС). Осоки встречаются
повсеместно, принимая участие в сложении пойменных фитоценозов. По
этой же причине ведущие места в родовом спектре заняли следующие роды:
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
46
Р.Х. Бордей, Л.Ф. Шепелева
Ranunculus, Rumex, Equisetum, Juncus, Eriophorum, которые на территории
ХМАО представлены в основном влаголюбивыми видами. Присутствие родов Artemisia, Potentilla, Amoria в ведущем родовом спектре флоры города
говорит о высокой антропогенной нагрузке.
Таким образом, анализ родового спектра исследуемой территории указывает на неравномерное распределение видов среди родов флоры города.
Большое число маловидовых родов и семейств указывает на сложности процесса флорогенеза и на значительную роль миграции в нем. В целом местоположение района исследований (территория г. Сургута), входящего в состав Циркумбореальной области Бореального подцарства Голарктического
флористического царства [15], определяет общие закономерности проанализированной систематической структуры флоры.
Биоморфологическая структура флоры Сургута
Изучение флоры не может быть полным без анализа жизненных форм, поскольку ее биоморфологическая структура отражает характер адаптации растений к набору условий среды, сложившихся в определенных экотопах. Поэтому
ее анализ служит надежным инструментом познания экологии местообитания.
Основой для анализа жизненных форм в наших исследованиях послужили системы жизненных форм И.Г. Серебрякова [16, 17] и К. Раункиера [18].
Таблица 3
Соотношение жизненных форм по И.Г. Серебрякову (1962) во флоре Сургута
Жизненная форма
1. Древесные растения:
Деревья
Кустовидные деревья
Кустарники
Кустарнички
2. Полудревесные растения:
Полукустарники
Полукустарнички
3. Травянистые многолетники:
3.1. Наземные травы
1. Стержнекорневые
2. Кистекорневые и короткокорневищные
3. Плотнокустовые дерновинные многолетники
4. Рыхлокустовые дерновинные многолетники
5. Длиннокорневищные
6. Столонообразующие и ползучие
7. Клубнеобразующие
3.2. Водные травы
4. Травянистые малолетники
1. Однолетники
2. Одно-двулетники
3. Двулетники
Всего:
Кол-во видов
абс.
%
37
10,1
10
2,7
6
1,6
12
3,3
9
2,5
4
1,1
3
0,8
1
0,3
240
65,4
27
60
5
21
85
28
5
9
86
55
18
13
367
7,4
16,2
1,4
5,7
23,2
7,6
1,4
2,5
23,4
15
4,9
3,5
100
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Характеристика флоры г. Сургута
47
Во флоре исследованной территории города соотношение жизненных
форм отражает общие закономерности умеренной зоны Северного полушария: травянистые жизненные формы преобладают над древесными, что проиллюстрировано в табл. 3.
Лидирующее положение во флоре исследуемого района занимает группа длиннокорневищных растений – 23,2% (Bromopsis inermis (Leyss.) Holub,
Calamagrostis epigeios (L.) Roth, Phalaroides arundinacea (L.) Rauschert, Equisetum arvense L., Tussilago farfara L. и др.), которые обладают максимальной
способностью к вегетативному разрастанию и размножению и отличаются
быстрым захватом территории.
Другую группу составляют виды, не способные к активному вегетативному размножению: стержнекорневые, короткокорневищные, плотнокустовые и клубнеобразующие – 126 видов (34,4% от общего количества видов).
Рыхлокустовые, дерновинные и длиннокорневищные многолетники, а
также столонообразующие и ползучие жизненные формы, отличающиеся
высокой вегетативной подвижностью, насчитывают 134 вида (36,5% от общего количества видов). Они приурочены, как правило, к избыточно влажным и рыхлым почвам.
Корнеотпрысковых травянистых многолетников во флоре города насчитывается 13 видов – 3,5% (Inula britannica L., Chamaenerion angustifolium
(L.) Scop, Sonchus arvensis L., Lactuca sibirica (L.) Maxim., Сirsium setosum
(Willd.) Bess. и др.), преимущественно это виды, заселяющие местообитания, подвергнувшиеся антропогенному воздействию.
Участие во флоре корнеклубневых растений незначительно. Среди них
отмечаются в основном представители семейства Orchidaceae.
Монокарпиков насчитывается 86 видов. Свой жизненный цикл они проходят за один или два года, завершая его цветением, плодоношением и отмиранием. Заметная доля участия этой группы в составе флоры объясняется
длительным и интенсивным антропогенным воздействием на растительный
покров изучаемой территории. Как правило, это сорные растения. В нашем
районе исследования широко распространены однолетние травы – Capsella
bursa-pastoris (L.) Medik., Lepidotheca suaveolens (Pursh) Nutt., Crepis tectorum L., Hordeum jubatum L., Lepidium ruderale L. и др. Особенно богато
сорняки представлены в семействах Brassicaceae и Chenopodiaceae.
Биологический спектр жизненных форм исследуемой флоры, по К. Раункиеру, в целом показывает количественное превосходство гемикриптофитов, что характеризует флору г. Сургута как умеренно холодную, голарктическую (табл. 4).
Фанерофитов во флоре г. Сургута немного (26 видов). Вообще, фанерофиты – растения мягкого климата. В нашем районе исследования они в подавляющем большинстве представлены видами, приспособленными к континентальному климату (Larix sibirica Ledeb., Pinus sibirica Du Tour., Pinus
sylvestris L. и др.).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Р.Х. Бордей, Л.Ф. Шепелева
48
Таблица 4
Биологический спектр флоры г. Сургута (по Раункиеру, 1905)
Жизненная форма
Фанерофиты
Хамефиты
Гемикриптофиты
Терофиты
Криптофиты
В том числе:
Геофиты
Гидрофиты
Всего:
абс.
26
16
175
73
77
Кол-во видов
51
26
367
%
7,1
4,4
48
19,6
21
13,9
7,1
100
Хамефиты представлены 16 видами растений. По И.Г. Серебрякову [16],
«климат хамефитов» свойствен холодной зоне, и действительно, большинство наших хамефитов, таких как Andromeda polifolia L., Arctostaphylos
uvaursi (L.) Spreng., Rubus idaeus L., Chamaedaphne calyculata (L.) Moench,
Ledum palustre L. присущи бореальной зоне. Особенно обильно они представлены в семействе Ericaceae.
Криптофиты и терофиты приспосабливаются к короткой вегетации, и в
связи с этим они распространены в различных экологических условиях. Терофиты господствуют в пустынных областях с сухим и жарким климатом,
поэтому во флорах умеренных широт, куда относится исследуемый район,
на долю терофитов приходится небольшое количество видов растений.
В основном это виды, которые относятся к сорной и адвентивной флоре.
Как известно, биологический спектр флоры региона отражает господствующие почвенно-климатические особенности изучаемого района. Для флоры
г. Сургута характерно значительное разнообразие жизненных форм. Преобладают виды травянистых растений (326 видов), что отражает типичные черты умеренно-холодных голарктических флор. Таким образом, биологические
спектры жизненных форм флоры г. Сургута, по И.Г. Серебрякову и по К. Раункиеру, характеризуют ее как типичную для Бореальной области.
Экологическая структура флоры Сургута
С целью выявления экологической структуры флоры и ее соответствия
спектру местообитания растений в г. Сургуте был проведен экологический
анализ флоры. Для выявления экологических особенностей изучаемой флоры были выделены группы растений с различным отношением к факторам
увлажнения и активного богатства и засоления почв. Основой для выявления экологических групп послужили стандартные экологические шкалы
[10, 11] по методике, предложенной Ю.В. Титовым [12]. Полученный экологический спектр флоры показывает разнообразие условий местообитаний
растений на территории города (табл. 5).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Характеристика флоры г. Сургута
Экологическая структура флоры г. Сургута
Экологическая группа (условное обозначение)
49
Таблица 5
Кол-во видов
абс.
По фактору увлажнения:
Ортоксерофиты
1
Мезоксерофиты
7
Ксерофиты
Гипоксерофиты
11
Гемиксерофиты
18
Ксеромезофиты
59
Мезофиты
Эумезофиты
119
Гидромезофиты
73
Гемигидрофиты
24
Гипогидрофиты
31
Гидрофиты
Ортогидрофиты
17
Гипергидрофиты
1
По фактору активного богатства и засоления почв:
Олиготрофы
12
Олиготрофы
Мезолиготрофы
26
Мезотрофы
Мезотрофы
82
Мезоэвтрофы
161
Эвтрофы
Эвтрофы
65
Гипогалофиты
7
Галофиты
Мезогалофиты
1
%
0,3
1,9
3
5
16,3
30,3
20,2
6,6
8,6
4,7
0,3
3,4
7,3
23,2
45,5
18,4
2
0,3
Анализ экологического спектра по фактору увлажнения среди гидроэкологических групп позволил выделить основную – мезофиты (51,6%), из них
на долю эумезофитов приходится 30,3%. Поскольку это растения, обитающие в условиях с более или менее достаточным, но не избыточным количеством воды в почве, их преобладание достигается за счет присутствия благоприятных условий увлажнения. Гидрофиты также представлены обильно
и занимают по численности второе место. Данный факт очевидно отражает
довольно широкую представленность на территории города сырых и болотистых местообитаний.
Анализ экологического спектра по фактору активного богатства и засоления почв позволил выделить наибольшее присутствие эвтрофов – 63,9%,
в частности на долю мезоэвтрофов приходится 45,5%, которым соответствуют довольно богатые почвы. В нашем случае, в границах селитебной части
города, это торфяные и торфяно-песчаные почвы, на которых произрастают
в основном газонные виды трав и виды, довольно требовательные к почвенному питанию. Как правило, это – заносные растения (адвенты): Artemisia
campestris L., A. glauca Pall. ex Willd., Festuca pratensis Huds., Medicago
sativa L., Sinapis arvensis L., Sisymbrium loeselii L., Amoria montana (L.) Sojak.
В пределах городской черты довольно большую площадь занимают слабо
нарушенные пойменные территории (пойма Оби, поймы притоков) естественного происхождения, которым соответствуют аллювиальные почвы,
богатые минеральными и органическими веществами, отличающиеся высоким плодородием. Вследствие этого растительность на подобных участ-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Р.Х. Бордей, Л.Ф. Шепелева
50
ках отличается значительным разнообразием, большинство видов растений
обладает повышенными требованиями к почвенному питанию. Это такие
виды, как: Alisma plantago-aquatica L., Bidens radiata Thuill., Carex acuta L.,
Juncus articulatus L., Phalaroides arundinacea (L.) Rauschert, Potamogeton
natans L., Rorippa palustris (L.) Bess., Stellaria palustris Retz., Tephroseris
palustris (L.) Reichenb., Thalictrum simplex L., Typha latifolia L.
Хорологическая структура флоры Сургута
Географический анализ имеет большое значение для выяснения происхождения изучаемой флоры, ее специфики и сводится в первую очередь к
составлению спектра географических элементов флоры (табл. 6).
Таблица 6
Хорологический спектр флоры Сургута
Космополитная
Видов
%
–
–
3
0,8
–
–
1
0,3
–
–
–
–
4
1,1
–
–
2
0,5
–
–
–
–
3
0,8
–
–
5
1,4
–
–
–
–
–
–
–
–
–
–
1
0,3
1
0,3
Всего
Североамериканская
Еврозападно-сибирская
Евросибирская
–
–
–
–
–
–
102
21
4
27,8
5,7
1,1
4
1
–
1,1
0,3
–
29
3
–
7,9
0,8
–
4
–
–
1,1
–
–
12
1
–
3,3
0,3
–
151
26
4
41,1
7,1
1,1
Азональная группа
Азиатская
3
0,8
119
32,4
–
–
8
2,2
–
–
20
5,4
150
40,8
Сибирская
Видов
%
Видов
Бореальная
%
Видов
Неморальная
%
Видов
Лесостепная
%
Видов
Степная
%
Видов
Плюризональная
%
Видов
Всего
%
Гипоарктическая
Евразиатская
Зональные элементы
Голарктическая
Географическая группа ареалов
3
0,8
251
68,4
5
1,4
41
11,2
7
1,9
34
9,3
–
–
26
7,1
Спектр географических элементов флоры г. Сургута отражает преобладание видов с широким ареалом. В этом спектре лидирующее положение
занимают виды евразиатской и голарктической групп, что указывает на обширные связи в прошлом с флорами Центральной Евразии и Голарктики.
Географический анализ выявил среди зональных (широтных) групп преобладание бореальных видов, что вполне согласуется с широтным положени-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Характеристика флоры г. Сургута
51
ем города. На виды, принадлежащие к плюризональной и космополитной
группам ареалов, в совокупности приходится 12,5% городской флоры, причем это в основном синантропные виды. Присутствие во флоре некоторого количества азиатских и одного североамериканского вида указывает на
антропогенную нагрузку в городе, это тоже пришлые (адвентивные) виды.
Процесс формирования флоры и растительности в Сургуте по сравнению
аналогичными процессами в других городах Западной Сибири, таких как
Тюмень [19], Томск [20], значительно отличается и характеризуется следующими особенностями, представленными в табл. 7. Увеличение в составе
флоры представителей семейства Cyperaceae говорит о высоком увлажнении местообитаний на городской территории. Наличие семейства Salicaceae
в десятке ведущих семейств города, вероятно, указывает на сохранение
исторического ядра флоры, поскольку большее число видов этого семейства
обитает в естественной, ненарушенной среде города (городские леса, парки,
окрестности города).
Таблица 7
Состав ведущих семейств во флоре гг. Сургута, Томска, Тюмени
№
п/п
1
2
3
4
5
Сургут
%
Томск
%
13,0
10,6
6,3
5,4
5,2
№
п/п
1
2
3
4
5
Asteraceae
Poaceae
Rosaceae
Brassicaceae
Fabaceae
10,6
10,2
6,0
5,9
4,9
№
п/п
1
2
3
4
5
Asteraceae
Poaceae
Cyperaceae
Rosaceae
Fabaceae
6–7
Brassicaceae
4,9
6–7
Cyperaceae
4,3
6
6–7 Caryophyllaceae
4,9
6–7
4,3
7–8
Polygonaceae 4,1
8
Ranunculaceae
9–10 Polygonaceae
3,8
3,3
8
9
4,0
3,2
7–8
9–10
4,1
3,3
9–10
3,3
10
Salicaceae
Caryophyllaceae
Ranunculaceae
Polygonaceae
Scrophulariaceae
3,1
Тюмень
%
Asteraceae 13,4
Poaceae
10,3
Fabaceae
5,6
Brassicaceae 5,5
Cyperaceae 5,3
Caryophyl4,5
laceae
Rosaceae
Lamiaceae
Scrophularia9–10
ceae
3,3
Заключение
На основании вышеизложенного можно сделать следующие выводы:
1. При исследовании урбанофлоры Сургута выявлено 367 видов сосудистых растений, относящихся к 220 родам и 67 семействам. Таксономический
анализ показывает преобладание семейств Asteraceae, Poaceae и Cyperaceae.
Присутствие этих семейств во флоре города в первой триаде семейственновидового спектра относит её к Голарктическому царству.
2. Спектр жизненных форм достаточно широк и в целом соответствует
спектрам бореальной флоры. В нем преобладают виды наземных многолетних трав, заметна также доля участия группы монокарпических трав. Это
объясняется интенсивным антропогенным воздействием на растительный
покров изучаемой территории. В целом травянистые растения составля-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
52
Р.Х. Бордей, Л.Ф. Шепелева
ют 88,8% флоры города. На долю деревьев, кустовых деревьев, кустарников, кустарничков, полукустарничков и полукустарников приходится лишь
11,2% флоры.
3. В экологическом спектре общей флоры по увлажнению преобладает
свита мезофитов (66,8%), представленная преимущественно группой эумезофитов. Также существенную долю в составе флоры города составляет свита гидрофитов (20,2%). В спектре экологических свит по активному
богатству и засолению почв преобладает свита эвтрофов, представленная
преимущественно мезоэвтрофами.
4. Хорологический анализ исследованной флоры показал, что она представлена видами с широкими евразиатскими и голарктическими ареалами.
Общая доля евросибирской, еврозападно-сибирской и сибирской географических групп составляет 9,3% от общего количества выявленных долготных
групп, тем самым показывая, что изначальное видовое разнообразие, исторически присущее данной территории, сохранилось довольно неплохо. Среди зональных элементов преобладает бореальная группа видов, что вполне
согласуется с широтным положением города.
5. В связи с суровыми климатическими условиями, присутствием на территории города значительного количества сырых и болотистых местообитаний, естественных ненарушенных зеленых зон, а также постоянным расширением границ города процесс формирования растительного покрова города
значительно отличается от аналогичных процессов в других сибирских городах. Флора г. Сургута в большей степени носит естественный характер.
Литература
1. Фролов А.К. Окружающая среда крупного города и жизнь растений в нем. СПб. : Наука, 1998. 328 с.
2. Экология северного города / под общ. ред. Н.А. Ивановой. Нижневартовск : Изд-во
Нижневарт. гуманит. ун-та, 2007. 158 с.
3. Экология и природопользование в Югре : материалы науч.-практ. конф., посвящ. 10-летию кафедры экологии СурГУ (Сургут, 16–17 октября 2009 г.). Сургут : ИЦ СурГУ,
2009. 152 с.
4. Бордей Р.Х., Шепелева Л.Ф. Адвентивные виды растений Сургута и Сургутского района // Оздоровление средствами образования и экологии : материалы VI Междунар.
науч.-практ. конф. Челябинск : Изд-во Челяб. гос. пед. ун-та, 2009. С. 212–216.
5. Полевая геоботаника / под общ. ред. И.М. Лавренко, А.А. Корчагина. М. ; Л. : Акад.
наук СССР, Ботанический ин-т им. В.Л. Комарова, 1959–1972. Т. 1–4.
6. Флора Сибири : в 13 т. / под ред. Л.И. Малышева, И.М. Красноборова, Г.А. Пешковой,
А.В. Положий. Новосибирск : Наука, 1988–1997.
7. Толмачев А.И. Введение в географию растений. Л. : Изд-во Ленингр. ун-та, 1974. 244 с.
8. Толмачев А.И. Методы сравнительной флористики и проблемы флорогенеза. Новосибирск : Наука, 1986. 195 с.
9. Ильминских Н.Г. Флорогенез в условиях урбанизированной среды (на примере городов
Вятско-Камского края) : автореф. дис. … д-ра биол. наук. СПб., 1993. 35 с.
10. Раменский Л.Г., Цаценкин И.А., Чижиков А.Н., Антипин Н.А. Экологическая оценка кормовых угодий по растительному покрову. М. : Гос. Изд-во сельхоз. лит., 1956. 472 с.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Характеристика флоры г. Сургута
53
11. Прокопьев Е.П. Экологические формулы и экологические группы растений поймы
Иртыша. Томск, 1990в. 42 с. Деп. в ВИНИТИ 25.06.90, № 2929-В90.
12. Титов Ю.В. Некоторые предложения к усовершенствованию экологической терминологии // Экология. 1975. № 4. С. 13–19.
13. Черепанов С.К. Сосудистые растения России и сопредельных государств. СПб. : Мир
и семья, 1995. 992 с.
14. Егорова Т.В. Осоки (Carex L.) России и сопредельных государств (в пределах бывшего СССР). СПб. ; Сент-Луис : Санкт-Петербургская ГХФА и Миссурийский ботанический сад, 1999. 772 с.
15. Тахтаджян А.Л. Флористические области Земли. Л. : Наука, 1978. 248 с.
16. Серебряков И.Г. Жизненные формы покрытосеменных и хвойных. М. : Высшая школа, 1962. 378 с.
17. Серебряков И.Г. Жизненные формы высших растений и их изучение // Полевая геоботаника. М. ; Л. : Наука, 1964. Т. 3. С. 146–205.
18. Raunkiaer C. Types biologiques pour la geographie botanique // Kgl. Danske vid. selsk.
forhandl. 1905. Vol. 5. P. 15–27.
19. Хозяинова Е.Ю. Флора травянистых растений в условиях урбанизированной среды
(на примере города Тюмени) : автореф. дис. … канд. биол. наук. Тюмень, 2004. 21 с.
20. Мерзлякова И.Е. Флора сосудистых растений города Томска : автореф. дис. … канд.
биол. наук. Томск, 1997. 23 с.
Поступила в редакцию ­­­­­­­­­­­­­­­­­­­­­­­­­­03.05.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 43–54
Rimma K. Bordey1, Ludmila F. Shepeleva2
Scientific and Research Institute of Nature Management and Ecology of the North
of Surgut State University, Surgut, the Khanty-Mansijsk Autonomous Distric, Russia
2
Surgut State University, Surgut, the Khanty-Mansijsk Autonomous Distric, Russia
1
SURGUT FLORA DESCRIPTION
The analysis of vegetation of the young West-Siberian cities is the most topical
as the pace of phytocoenoses (plant communities) destruction in these cities are very
rapid due to intensive housing development and constant expanding of city limits. City
vegetation development is a vivid example of the process of current flora changes under
anthropogenic influence.
The subject of this work is flora of Surgut. The materials for this article were
collected during the author’s field studies held in 2002–2010 within the administrative
limits of Surgut. The rout method of collecting of the materials was applied. All the
main habitats of Surgut were examined including natural and anthropogenic habitats.
Standard botanic methods were used for analyzing the collected material. The collected
material allowed to carry out floristic analysis of the vegetation, including taxonomic,
biomorphologic, ecologic and geographic analyses.
Taxonomic analysis of the flora reviled 367 species of vascular plants, related
to 220 genera and 67 families. The analysis reflects that Asteraceae, Poaceae,
Cyperaceae families are dominant. The presence of these families in the first tirade of
genus-family spectrum (range) shows that the city’s flora belongs to Golarctic kingdom.
The ascertained spectrum (range) of life-forms corresponds to the boreal flora spectra
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
54
Р.Х. Бордей, Л.Ф. Шепелева
(ranges). Terrain perennial herbs prevail in the spectrum with a significant share of
monocarpic herbs. This can be explained by intensive anthropogenic influence on the
area under study. Herbaceous plans comprise 90% of the city’s flora. Trees, bushed
trees, shrubs and under shrubs comprise 11,2%. Mesophytes, mostly represented by
eumesophytes, prevail in the flora ecologic spectrum classified by humidification
factor (66,8%). Hydrophytes comprise a significant share as well (20,2%). Eutotrophs,
mostly represented by mesoeutotrophs, prevail in the flora ecologic spectrum classified
by soil active richness and salinity. Chorologic analysis of the flora revealed that it is
represented by the species with broad Eurasian and Golarctic areas. The combined
share of Eurosibirian, Eurowest-Siberian and Siberian geographic groups comprises
9,3% of the total number of discovered longitude groups. This fact proves that the
original specific variety historically attributed to this area has badly preserved. The
boreal group prevails among zonal elements which corresponds to the latitudinal
position of the city. Due to severe climate, significant quantity of wet and swamp
areas and natural undisturbed green areas, as well as constant expansion of city
limits, the process of vegetation formation differs greatly from such processes in other
Siberian cities.
Key words: Surgut; city vegetation; vegetation comparative analysis.
Received May 03, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 55–65
УДК 582.542
М.В. Олонова1, Н.В. Храброва2
Биологический институт Томского государственного университета (г. Томск)
2
Особое структурное подразделение «Научно-исследовательский институт
биологии и биофизики Томского государственного университета» (г. Томск)
1
ИССЛЕДОВАНИЕ ГЕНЕТИЧЕСКОГО СХОДСТВА
Poa nemoralis L. И Рoa palustris L. (Рoaceae)
НА БАЗЕ НУКЛЕОТИДНЫХ ПОСЛЕДОВАТЕЛЬНОСТЕЙ
РАЙОНА ETS 18S-26S ЯДЕРНОЙ РИБОСОМНОЙ ДНК
Исследования выполнены при финансовой поддержке РФФИ (грант № 10-04-00637-а).
Для выявления генетического сходства был секвенирован район внешнего
транскрибируемого спейсера (ETS) 18S-26S ядерной рибосомной ДНК у 10 представителей Pоа palustris L. и одного P. nemoralis L. Исследование выявило слабую изменчивость этого района. Сравнение с данными, полученными из GenBank,
подтвердило тесные связи P. palustris не только с P. nemoralis, но и с P. glauca
Vahl., P. laxa subsp. flexuosa (Sm.) Hyl. (который, как считается, произошел от
гибридизации P. laxa with P. glаuca) и даже с P. lettermanii Vasey (sect. Abbreviatae
Nannf. еx Tzvel.). Район ETS оказался слишком консервативным для исследования
отношений между видами Роа, поэтому для этой цели должны быть испробованы другие методы.
Ключевые слова: ETS; Poa nemoralis L.; Роа palustris L.; систематика.
Введение
Попытка филогенетической реконструкции секции Stenopoa Dumort.,
проводившаяся на базе классических морфологических и эколого-географических методов, выявила ряд спорных мест и поставила множество вопросов, для разрешения которых требуется применение молекулярно-генетических методов. Одной из центральных проблем филогении секции являются
родственные взаимоотношения двух мезоморфных видов – P. nemoralis L. и
Р. palustris L.
Н.Н. Цвелев [1], предполагая высокогорное происхождение мятликов,
считает, что P. nemoralis и P. palustris более других видов секции приближаются к общим предковым типам, обитавшим в относительных высокогорьях
конца палеогена, причем сформировались они по-разному и в разных поясах
гор. Более специализированный P. nemoralis обитал в поясе тургайских листопадных лесов еще до спуска их на межгорные равнины, а менее специализированный P. palustris –­­­­­­­­­­ в поясе южнотаежных лесов, располагавшемся
выше. В конце миоцена в результате возросшей континентализации климата
отдельные элементы уже спустившихся к тому времени на равнины тургай-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
56
М.В. Олонова, Н.В. Храброва
ских лесов стали замещаться спускающимися с гор таежными элементами.
В результате P. nemoralis, оказавшийся в числе наиболее устойчивых элементов тургайской флоры, вошел в состав плиоценовых смешанных лесов.
Плейстоценовое смещение границ привело к массовой гибридизации между
P. nemoralis и более светолюбивым P. palustris [1].
М.Г. Попов [2] высказал предположение, что P. nemoralis, лесной неморальный мятлик, в плейстоцене мигрировал на юг вместе с обедненными
тургайскими лесами, где и остался в горно-лесных группировках в качестве
плейстоценового реликта. Впоследствии в результате изменений рельефа и
климата этот вид дал, по мнению П.Н. Овчинникова [3], целый ряд специализированных криофильных и ксерофильных альпийских и степных видов. P. palustris, по предположению Т.И. Серебряковой [4], является производным от лесного предка и представляет собой достаточно древний вид,
возникший в результате «местной» адаптации к луговым условиям. Лесное
происхождение P. nemoralis не вызывает сомнений, однако с лесным происхождением P. palustris согласиться трудно. Как уже отмечалось ранее,
Н.Н. Цвелев совершенно справедливо заметил: если в пределах одного современного рода фестукоидных злаков имеются как лесные, так и луговые
виды, не следует выводить одни из других, так как обе эти экологические
группы произошли от общего высокогорного предка [5]. Более вероятным
представляется перемещение P. palustris вниз не под пологом южнотаежных лесов, а по открытым участкам, опушкам лесов, вдоль рек и ручьев.
Дальнейшая эволюция секции шла главным образом по пути ксероморфогенеза. Современные виды P. nemoralis и P. palustris, по-видимому, нельзя
считать непосредственными родоначальниками других видов, но они более других сохранили черты строения древних предков. И P. nemoralis, и
P. palustris в настоящее время отличаются очень высоким полиморфизмом,
у них отмечаются наиболее высокие и разнообразные хромосомные числа.
Это свидетельствует о том, что их эволюция продолжается в мезофильных
условиях, а сами они уже не так примитивны, как их предки, давшие, вероятно, начало большинству видов cекции.
В нашей стране и за рубежом проводилась большая работа по изучению мятликов, при этом пересматривалась и корректировалась и система
рода, и система секции Stenopoa. Так, Е.Н. Пояркова [6], критически пересмотревшая систему рода в пределах флоры Украины с привлечением анатомических и других данных, предложила разделить секцию Stenopoa на
две подсекции: Nemorales, объединяющую мезоморфные виды, и Steriles,
включающую эволюционно более продвинутые ксероморфные виды секции. Эту точку зрения поддержала Н.С. Пробатова [7, 8]. Такое внутрисекционное подразделение подразумевает, что родство между P. nemoralis и
P. palustris значительно более тесное, чем, например, между P. nemoralis и
P. sterilis Bieb., c одной стороны, и P. palustris и P. stepposa (Kryl.) Roshev. –
с другой.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Исследование генетического сходства
57
Изучение большой и сложной группы мятликов секции Stenopoa ставит
под сомнение правомерность подразделения секции Stenopoa на подсекции
Nemorales и Steriles. В свете изученных особенностей распределения качественных признаков, маркирующих родственные группы видов (длина язычка и характер поверхности оси колоска), представляется более вероятным,
что лесной P. nemoralis и луговой P. palustris – наиболее древние виды этой
секции – дали начало двум эволюционным линиям (рядам в понимании Комарова). Эти линии лишь частично объединялись в результате гибридизации,
образовав сложные гибридные комплексы, рассматривающиеся как агрегаты
P. x intricata Wein и P. urssulensis Trin. В дальнейшем обе линии дали ксероморфные виды, но сходство между ними, по-видимому, чисто конвергентное,
основанное на сходстве адаптивных признаков, а не на признаках родства.
Для того же, чтобы классификация отражала естественную историю группы,
к чему мы по возможности стремимся, необходимо, как напоминают О. Солбриг и Д. Солбриг [9], чтобы все члены рассматриваемого таксона были близкородственными между собой и происходили от общего предка.
Таким образом, возникает вопрос, как давно произошла дифференциация
этих видов. Предложенная Н.Н. Цвелевым [5] схема эволюционных взаимоотношений, как и всякая гипотеза, нуждается в проверке альтернативным
методом, и проверку следует начать с самого основания системы, т.е. постараться выявить степень генетических различий между видами P. nemoralis и
P. palustris, предположительно лежащих в основании двух основных ветвей
эволюционного дерева секции. Морфологически и габитуально эти виды
очень сходны, и различия между ними значительно меньше, чем между
ними и их ксероморфными дериватами, но не отражают глубины родственных отношений, а могут быть следствием конвергентного сходства. Для выявления глубины дифференциации видов и, следовательно, их положения в
системе следует изучить их генетическую дифференциацию. Вместе с тем
следует принять во внимание и то, что их генетическая близость может свидетельствовать не только об их относительно недавней дифференциации, но
и о вторичном сближении, обусловленном массовой гибридизацией во время плейстоценовых смещений растительных зон.
Для выявления степени генетических различий между морфологически
близкими видами P. nemoralis и P. palustris было начато молекулярно-генетическое исследование видов секции. Надо отметить, что род мятлик к настоящему
времени относительно неплохо изучен в молекулярно-генетическом отношении и продолжает изучаться. Тем не менее многочисленные работы Р. Соренг
[10–12], Л.Дж. Джилеспи [13–16], А.В. Родионова и Н.Н. Носова [17–19 и др.]
посвящены филогении рода в целом, а детальное исследование S. Stoneberg
Holt [20, 21 др.] касается главным образом P. pratensis L. Специального молекулярно-генетического исследования секции Stenopoa не проводилось.
Как отметили А.С. Антонов [22] и В.С. Шнеер [23], к настоящему времени среди исследованных последовательностей ДНК растений преоблада-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
58
М.В. Олонова, Н.В. Храброва
ют хлоропластные, но большая часть наследственной информации сосредоточена в ядерном геноме. Кроме того, недостатком хлоропластной ДНК
является ее унипарентальное наследование. Это приводит к тому, что при
исследовании близких видов филогенетические деревья, реконструированные на основе этого участка, могут отличаться от таковых, полученных в
результате исследования геномов с бипарентальным наследованием [23, 24].
Более объективные результаты дает исследование генов рибосомных РНК.
Эти гены представлены длинными тандемными повторами. Каждый такой
повтор включает 3 гена – 18S, 5.8S и 26S, разделенных внутренними транскрибируемыми спейсерами ITS1 и ITS2 (internal transcribed spacer). Снаружи
от генов размещаются внешние транскрибируемые спейсеры (ETS). Разделяются эти транскрибируемые повторы нетранскрибируемыми спейсерами
NTS (non-transcribed spacer) [25]. Последовательность ITS1 и ITS2 в настоящее время широко используется для исследования взаимоотношений близкородственных таксонов уровня семейства и выше [26], тем не менее, как
отмечает В.С. Шнеер [23], на низких таксономических уровнях вариабельность этих участков становится слишком низкой. И действительно, исследования L.J. Gillespie с коллегами [27] не выявили различий между P. nemoralis
и P. palustris по последовательности ITS1 и ITS2.
Многие исследователи [23, 28, 29] указывают на более высокую изменчивость участка ETS. Б.Дж. Болдвин и С. Маркос [30] отмечают, что
доля изменчивых и потенциально информативных сайтов на участке ETS
от 1,3 до 2,4 раза выше, чем на ITS1 + ITS2, а Р. Асеведо-Розак с соавт.
[31] показывает, что участок ETS на 34,4% более информативен, чем другие исследованные последовательности. T. Орландо c соавт. [32] объясняют это тем, что ETS и IGS находятся под меньшим давлением отбора,
и это позволяет им лучше сохранять мутации и, следовательно, определять родственные отношения. Тем не менее ETS используется для филогенетических исследований значительно реже, чем ITS. Л.Дж. Джилеспи
(личное сообщение) видит причину этого в том, что участок ETS много
длиннее, чем ITS, и не имеет универсальных праймеров, т.е. праймеров,
пригодных для большинства растений. Поэтому для каждой группы растений требуется подбирать свои праймеры, и это серьезно усложняет исследования.
Поскольку известно, что исследование ITS1 и ITS2 последовательностей
не выявляет различий между P. nemoralis и P. palustris [33], была предпринята попытка выявить ее с помощью анализа нуклеотидных последовательностей ETS (внешний транскрибируемый спейсер, расположенный между
26S и 18S рибосомной ядерной последовательности).
Цель данного исследования – оценить степень генетического сходства
между P. palustris и P. nemoralis. Поскольку ETS P. nemoralis уже была исследована [27], основное внимание было сосредоточено на P. palustris.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Исследование генетического сходства
59
Материалы и методики исследования
Исследования проведены в Центре коллективного пользования Томского
государственного университета «Экоген» на десяти образцах P. palustris и –
для сравнения – одном P. nemoralis, отобранных из природных популяций
(табл. 1). ДНК выделяли из листьев, высушенных в силикагеле или взятых
из гербарных материалов, по стандартной методике Doyle and Doyle [34] с
небольшими модификациями. Небольшие кусочки листьев, взятых с гербарных образцов, растирались в фарфоровой ступке с 700 мкл СТАБ-буфера,
затем жидкая фракция переносилась с помощью пипетки в пробирки.
Исследованные популяции
Таблица 1
Место
№
хранения
МестообитаМестонахождение
Вид
Коллектор
образца ваучера
ние
[35]
Алтай, окр.
Опушка
09–61
TO
Poa nemoralis М.В. Олонова
с. Кибезень
елового леса
Кузнецкий Алатау, урочище
08–47
TO
Берег ручья
М.В. Олонова
Poa palustris
Айдат, приток
Белого Июса
Томск, р-н
Пустырь
09–42
TO
А.Л. Эбель
Poa palustris
ул. Торговой
на песке
Томская обл., КоОбрывистый
09–48
TO
жевниковский р-н,
А.Л. Эбель
Poa palustris
берег реки
с. Киреевск
Алтай,
Опушка ело09–52
TO
М.В. Олонова
Poa palustris
окр. с. Акташ
вого леса
09–93
TO
Скандинавия
Луг
R.J. Soreng
Poa palustris
Кемеровская обл.,
Чебулинский р-н, Разнотравный
С.А. Шеремето09–66
KUZ
Poa palustris
3 км к СВ
луг
ва, Е.А. Буко
от с. Чумай
Горная Шория,
окр. пос. Усть- Прибрежный
С.А. Шеремето09–69
KUZ
Poa palustris
Анзас, берег
галечник
ва, Е.А. Буко
р. Мрассу
Кемеровская обл.,
Междуреченский
РазнотравноС.А. Шеремето09–72
KUZ
р-н, КрасногорPoa palustris
злаковый луг
ва, Е.А. Буко
ский угольный
разрез
Якутия , Яно-Ин- Разнотравно09–85
TO
Е.Г. Николин
Poa palustris
дигирский р-н
злаковый луг
Красноярский
край, Канский Опушка бере09–98
TO
М.В. Олонова
Poa palustris
р-н, окр. ж/д стан- зового леса
ции Солянка
Примечание. TO – Гербарий им. П.Н. Крылова Томского государственного университета
(г. Томск); KUZ – Гербарий Кузбасского ботанического сада Института экологии человека
СО РАН (г. Кемерово).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
60
М.В. Олонова, Н.В. Храброва
После добавления 10 мкл РНКазы пробирки встряхивались на вортексе
в течение 5 с и затем в течение 80 мин инкубировались в термостате при
65ºС при периодическом мягком взбалтывании. Затем в пробирки добавлялось 700 μл очистительного раствора «хлороформ-изоамиловый спирт»,
после чего содержимое перемешивалось в течение 20 мин на ротационном вортексе. Затем смесь центрифугировалась на максимальной скорости
(13 000 об./с) в течение 5 мин, верхняя фракция (супернатант) переносилась в новую пробирку, и процедура очистки повторялась еще раз. Далее для
осаждения ДНК добавлялось 350 мкл холодного изопропанола, содержимое
встряхивалось на вортексе на минимальной скорости в течение 1 мин и центрифугировалось на максимальной скорости в течение 10 мин. После чего
изопропанол аккуратно с помощью пипетки удалялся, а осажденная ДНК
промывалась 350 μл 70%-ного этилового спирта. Затем спирт также удалялся и ДНК высушивалось на воздухе до полного испарения спирта. После
этого ДНК растворяли в 100 мкл деионизированной воды, пробирки помещались на хранение в морозильную камеру и хранились при t –20°С.
Для амплификации по совету Л.Дж. Джилеспи (личное сообщение) в качестве прямого праймера был использован RETS4_F (TGGCTACGCGAGCGCATGAG), подобранный специально Л.Дж. Джилеспи и коллегами для
исследования мятликов [36], а обратного – 18S-R (AGACAAGCATATGACTACTGGCAGG), одного из стандартных праймеров. Праймеры были синтезированы фирмой «СибЭнзим» (г. Новосибирск).
Реакционная смесь содержала однократный ПЦР-буфер (60 мМ Tris –
HCl, 25 мM KCl, 10 мM 2 – меркаптоэтанол, 0,1%-ный Тритон Х – 100),
1,5 мM MgCl2, 200 мкM каждого dNTP, 1 единицу активности TaqДНКполимеразы («СибЭнзим», г. Новосибирск), по 5 пмоль праймеров, 10 нг
геномной ДНК и деионизованную воду до объема 15 мкл. Амплификацию
проводили в программируемом термоциклере MJ Mini™ Personal Thermal
Cycler (Bio-Rad, США). Условия амплификации: первичная денатурация
ДНК – 3 мин при 94ºС, затем 35 циклов, включающих три этапа: 30 с при
94ºС, 30 с при 57ºС, 1 мин при 72ºС; финальная достройка цепей – 10 мин
при 72ºС, затем охлаждение до 4ºС. Продукты амплификации разделяли в
1,5%-ном агарозном геле в однократном ТАЕ-буфере (0,04М трис-ацетат,
0,002М ЭДТА) при напряжении 100 V, окрашивали бромистым этидием
(1 мкг/мл), визуализировали в ультрафиолетовом свете и фотодокументировали. Оценку размеров фрагментов ДНК осуществляли относительно 100 bp
+ 1,5 kb ДНК-маркера («СибЭнзим»). Полученные изображения обрабатывали в программе Adobe®Photoshop® CS2. Продукты амплификации очищали
с использованием набора GeneJet TM PCR Purification Kit (Ferments, EU).
Секвенирование проводили на приборе 3130 Genetic Analyzer с использованием BigDye® Terminator v3.1 Cycle Sequencing Kit (Applied Biosystems,
США). Для редактирования нуклеотидных последовательностей применяли
программу Sequencing Analysis 5.2 (Applied Biosystems, США). Анализ, вы-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Исследование генетического сходства
61
равнивание последовательностей осуществляли с помощью программ SeqMan™ II и MegAlign™ (DNASTAR Inc.).
Результаты исследования и обсуждение
Полученная ETS-матрица содержит 570 пар оснований. Сравнение нуклеотидных последовательностей показало высокую степень сходства районов ETS P. nemoralis и P. palustris. Тем не менее некоторые различия, явные
и неявные, все же удалось установить. Явные различия были обнаружены в
позициях нуклеотидов 44, 537, 538 и 562. В основном имели место транзиции (замена пурина на пурин или пиримидина на пиримидин), в одном случае была зарегистрирована трансверсия (замена пиримидина на пурин или
пурина на пиримидин): в позиции 538 у P. nemoralis стоит R, что может означать аденин или гуанин, а у всех P. palustris, у которых отсеквенировался
этот участок, на этом месте располагается цитозин). И, наконец, в позиции
44 у P. nemoralis была обнаружена делеция, а у P. palustris – аденин. Интерес
представляет также 136-я позиция, где у P. nemoralis стоит цитозин, у образцов № 3, 5, 7 P. palustris – аденин, а у остальных образцов эта позиция
выпадает вообще, т.е. имеют место и трансверсия, и делеция.
Вместе с тем были обнаружены неявные различия. Так, в позиции 43 у
P. palustris стоит цитозин, а у P. nemoralis – М, что может означать и цитозин,
и тимин; в позиции 161 у P. palustris располагается гуанин, а у P. nemoralis –
S, что может означать и гуанин, и цитозин. Однако, вероятнее всего, это
ошибки идентификации нуклеотидов; такие сравнения не совсем корректны, поскольку у P. nemoralis исследовался всего один экземпляр, тем не
менее некоторое представление о генетическом сходстве видов оно дает.
Исследование полученных нуклеотидных последовательностей района
ETS рибосомной ДНК P. palustris выявило невысокую изменчивость данного фрагмента. Всего у четырех образцов были выявлены хотя бы какие-то
отличия. Наиболее изменчивым оказался этот фрагмент у образца № 5, собранного на Алтае. У него обнаружилось 8 замен, из них в позициях 111,
113, 316, 355 и 356 имели место транзиции, а в 535, 536 и 537 – трансверсии.
В четырех позициях (316, 355, 356 и 537) наблюдались транзиции у образца 7 из Кемеровской области, транзиция в позиции 316 и делеция в позиции
537 были обнаружены в образце № 2 (Кузнецкий Алатау), и, наконец, делеция была выявлена в 89-й позиции образца №3 (г. Томск).
Для выявления различий в нуклеотидной последовательности ETS
P. nemoralis и P. palustris были привлечены данные Gen Bank Национального центра биотехнологической информации США [33] и программа для
сравнивания последовательностей BLAST (basic local alignment search tool).
Эта программа позволяет исследователю сравнивать интересующие его последовательности с последовательностями, хранящимися в базе данных [37].
Сравнения показали не только высокую степень сходства между P. palustris
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
М.В. Олонова, Н.В. Храброва
62
и P. nemoralis (табл. 2), но также и сходство этих видов с P. glauca Vahl. (sect.
Stenopoa), P. lettermanii Vasey (sect. Abbreviatae Nannf. Ex Tzvel.) и P. laxa subsp.
flexuosa (Sm.) Hyl. Последний, по мнению R. Soreng [38], образовался в результате гибридизации P. glauca и P. laxa Haenke (ssect. Oreinos Asch. et Graеb.).
Таблица 2
Степень генетического сходства исследованных сибирских P. nemoralis
и P. palustris с близкими видами мятликов, представленными в GenBank
Аминокислотные последовательности района ETS
рибосомной ДНК из GenBank
№
GQ324324.1
GQ324355.1
GQ324345.1
GQ324342.1
Происхождение образца
Вид
CAN: Gillespie 5804
P. glauca
BRNU: Hajkova et al. 2004-18 P. nemoralis
US: Soreng & Soreng 7434
P. lettermanii
P. laxa subsp.
Brochmann 2000-3 (1or 3)
flexuosa
Степень сходства
(max. ident.) с исследованными сибирскими
образцами, %
P. nemoralis P. palustris
98
99
97
98
97
97
97
98
При этом надо отметить, что два последних вида, хотя и близки по происхождению к видам секции Stenopoa, относятся даже к другим секциям.
Заключение
Исследование нуклеотидных последовательностей ETS рибосомной
ДНК P. palustris показало слабое генетическое отличие по этому признаку
не только от близкого вида P. nemoralis, но даже и от видов близких секций.
Проведенное исследование показало, что участок ETS, как и ITS, недостаточно информативен для исследования родственных отношений на внутрисекционном уровне. Для решения задач на этом уровне следует попробовать
другие методы молекулярного анализа.
Авторы благодарны д-ру L.J. Gillespie (Музей естественной истории, г. Оттава, Канада) и д-ру T. Giraud (Университет Париж-Юг, Орсэ,
Франция) за ценные советы; канд. биол. наук А.Л. Эбелю (Томский государственный университет, г. Томск); канд. биол. наук С.А. Шереметовой, канд.
биол. наук Е.А. Буко (Кузбасский ботанический сад, г. Кемерово) и Е.Г. Николину (Институт биологических проблем криолитзоны СО РАН, г. Якутск)
за предоставленные гербарные образцы P. palustris.
Литература
1. Цвелев Н.Н. К систематике мятликов (Poa L.) европейской части СССР // Новости систематики высших растений. 1972. Т. 9. С. 47–54.
2. Попов М.Г. Флора Средней Сибири. М. ; Л. : Изд-во АН СССР, 1957. Т. 1. 555 с.
3. Овчинников П.Н. Основные направления видообразования в связи с происхождением
типов растительности Средней Азии // Труды АН Таджикской ССР. 1955. Вып. 31.
С. 19–33.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Исследование генетического сходства
63
4. Серебрякова Т.И. Побегообразование и жизненные формы некоторых мятликов (Poa L.)
в связи с их эволюцией // Ботанический журнал. 1965. Т. 50, № 11. С. 1536–1556.
5. Цвелев Н.Н. О роде мятлик (Poa L.) в СССР // Новости систематики высших растений.
1974. Т. 11. С. 24–41.
6. Пояркова Е.Н. Мятлики флоры Украинской ССР : автореф. дис. ... канд. биол. наук.
Харьков, 1965. 15 с.
7. Пробатова Н.С. К вопросу о системе рода мятлик (Poa L.) в связи с изучением его дальневосточных представителей // Комаровские чтения. Владивосток, 1969. Вып. 15–17.
С. 117–127.
8. Пробатова Н.С. Семейство мятликовые, или злаки // Сосудистые растения советского
Дальнего Востока. Л., 1985. Т. 1. С. 89–382.
9. Солбриг О., Солбриг Д. Популяционная биология и эволюция. М. : Мир, 1982. 488 с.
10. Soreng R.J. Chloroplast-DNA and biogeography in a reticulating group: study in Poa (Poaceae) // Amer. J. Bot. 1990. Vol. 77, № 11. Р. 1383–1400.
11. Soreng R.J., Davis J.I., Doyle J.J. A phylogenetic analysis of chloroplast DNA restriction
site variation in Poaceae subfam. Pooideae // Pl. Syst. Evol. 1990. Vol. 172. P. 83–97.
12. Soreng R.J., Davis J.I. Phylogenetic structure in Poaceae subfamily Pooideae as inferred
from molecular and morphological characters: misclassification versus reticulation //
Grasses systematisc and evolution / eds. S.W. L. Jacobs, J. Everett. Melbourne, 2000.
P. 61–74.
13. Gillespie L.J., Consaul L.L., Aiken S.G. Hybridisation and the origin of the arctic grass Poa
hartzii (Poaceae): evidence from morphology and hloroplast DNA restriction site data //
Can. J. Bot. 1997. Vol. 75. P. 1978–1997.
14. Gillespie L.J., Boles D. R. Phylogenetic relationships and infraspecific variation in Canadian Arctic Poa based on chloroplast DNA restriction site data // Can. J. Bot. 2001. Vol. 79.
P. 679–701.
15. Gillespie L.J., Soreng R.J. A phylogenetic analysis of the Bluegrass genus Poa based on
cpDNA restriction site data // Syst. Bot. 2005. Vol. 30, № 1. P. 84–105.
16. Gillespie L.J., Archambault A., Soreng R.J. Phylogeny of Poa (Poaceae) based on trnTt–rnF
sequence data: major clades and basal relationships // Aliso. 2007. Vol. 23. P. 420–434.
17. Родионов А.В., Ким Е.С., Пунина Е.О. и др. Эволюция хромосомных чисел в трибах
Aveneae и Poeae по данным сравнительного исследования внутренних транскрибируемых спейсеров ITS1 и ITS2 ядерных генов 45S рРНК // Ботанический журнал. 2007.
Т. 92, № 1. С. 57–71.
18. Родионов А.В., Носов Н.Н., Ким Е.С. и др. Происхождение полиплоидных геномов
мятликов (Poa L.) и феномен потока генов между Северной Пацификой и субантарктическими островами // Генетика. 2010. Т. 46, № 12. С. 1598–1608.
19. Носов Н.Н., Родионов А.В. Молекулярно-филогенетическое изучение взаимоотношений между представителями рода Poa (Poaceae) // Ботанический журнал. 2008. Т. 93,
№ 12. С. 1919–1936.
20. Stoneberg Holt S. D., Horova L., Bureš P. Indel patterns of the plastid DNA trnL–trnF region within the genus Poa (Poaceae) // Journal of Plant Research. 2004. № 117. Р. 393–407.
21. Stoneberg Holt S. D., Horová L., Bureš P. et al. The trnL-F plastid DNA characters of three
Poa pratensis (Kentucky bluegrass) varieties // Plant, Soil and Environment. 2005. № 51.
Р. 94–99.
22. Антонов А.С. Основы геносистематики высших растений. М. : МАИК Наука / Интерпериодика, 2000. 135 с.
23. Шнеер В.С. Краткий очерк способов получения, обработки и трактовки данных по
последовательностям ДНК в систематике растений. II. Методы построения филогенетических деревьев и оценки их достоверности; о выборе таксонов и последовательностей ДНК для анализов // Ботанический журнал. 2005. Т. 90, № 3. С. 304–329.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
64
М.В. Олонова, Н.В. Храброва
24. Hoggard G.D., Kores P.J., Molvary M., Hoggard R.K. The phylogeny of Gaura (Onagraceae) based on ITS, ETS, and trnL-F sequence data // American Journal of Botany. 2004.
Vol. 91. P. 139–148.
25. SpringerImages. URL: http://www.springerimages.com/Images/ LifeSciences
26. Baldwin B.G., Sanderson M.J., Porter J.M. et al. The ITS regoin of nuclear ribosomal
DNA: a valuable source of evidence on Angiosperm Phylogeny // Ann. Missouri. Bot.
Gard. 1995. Vol. 82. P. 247–277.
27. Gillespie L.J., Soreng R.J., Bull R. et al. Phylogenetic Relationships in Subtribe Poinae
(Poaceae, Poeae) Based on Nuclear ITS and Chloroplast trnT-trnF Sequences // Botany.
2008. № 86. P. 938–967.
28. Linder C.R., Goertzen L.R., Heuvel B.V. et al. Phylogenetic utility at low taxonomic levels
in Asteraceae and closely allied families // Molecular Phylogenetics and Evolution. 2000.
Vol. 14. P. 285–303.
29. Morgan D.R. nrDNA external transscribed spacer (ETS) sequence data, reticulate evolution, and systematic of Machaeranthera (Asteraceae) // Syst. Bot. 2003. Vol. 28, № 1.
Р. 179–190.
30. Baldwin B.G., Marcos S. Phylogenetic utility of the external transcriber spacer (ITS) of
18S-26S rDNA: congruence of ETS and ITS trees of Calycadenia (Compositae) // Molecular Phylogenetic and Evolution. 1998. Vol. 10. P. 449–463.
31. Acevedo-Rosas R., Cameron K., Sosa V., Pell S. A molecular phylogenetic study of Graptopetalum (Crassulaceae) based on ETS, ITS, RPL16, and TRNL-F nucleotide sequences //
American Journal of Botany. 2004. Vol. 91. P. 1099–1104.
32. Orlando T., Rubio M.A., Sturm N. et al. Intergenetic and external transcribed spacers of
ribosomal RNA genes in lizard-infecting Leishmania: molecular structure and phylogenetic
relationship to mammal-infecting Leishmania in the subgenus Leishmania (Leishmania) //
Mem. Inst. Rio de Janeiro : Oswaldo Cruz, 2002. Vol. 97. P. 100–107.
33. Gen Bank. URL: http://www.ncbi.nlm.nih.gov
34. Фризен Н. Молекулярные методы, используемые в систематике растений. Барнаул :
АзБука, 2007. 64 с.
35. Holmgren P.K., Holmgren N.H., Barnett L.C. Index Herbariorum: A global directory of public herbaria and associated staff. New York Botanical Garden’s Virtual Herbarium. URL:
http://sweetgum.nybg.org/ih
36. Gillespie L.J., Soreng R.J., Jacobs S.W.L. Phylogenetic relationship of Australian Poa (Poaceae: Poinae), including molecular evidence for two new genera, Saxipoa and Sylvipoa //
Austr. Syst. Bot. 2009. Vol. 22. P. 413–436.
37. Лукашов В.В. Молекулярная эволюция и филогенетический анализ. М. : Бином, 2009.
256 с.
38. Soreng R.J. Poa L. – The Bluegrass // Flora of North. America north of Mexico / eds. by
M.E. Barkworth, C.A. Capels, S. Long, L.K. Anderton, M. Piep. New York ; Oxford :
Oxford Univ. Press, 2007. Vol. 24. P. 486–601.
Поступила в редакцию 03.08.2011 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Исследование генетического сходства
65
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 55–65
Marina V. Olonova1, Natalia V. Khrabrova2
RESEARCH OF GENETIC SIMILARITY OF Poa nemoralis L.
AND Рoa palustris L. (РОАСЕАЕ), BASED ON ETS OF 18S-26S NR DNA
SEQUENCE DATA
An attempt of phylogenetic reconstruction of section Stenopoa Dumort. (genus Poa L.),
based on classic morphological and ecologo-geographycal methods, has revealed a lot of
controversial points, which can be settled by using of the molecular methods, as alternative
method of research. The relationship of both mesomorphic species (Poa nemoralis L. and
Р. palustris L.), which are supposed to be situated on the base of the main branches of phylogenetic tree of section, is one of the main problems of section phylogeny. These species
are very similar both in their morphology and habitus, and the difference between them
is much less, then the difference between their xeromorphic derivates. Nevertheless, this
difference does not express the degree of relationship, but may be caused by convergent
similarity. The genetic differentiation of these species should be searched for eliciting of
their divergence, and, consequently, their position in the section system.
As far as ITS1 and ITS2 sequences are known to not reveal the differences between
P. nemoralis and P. palustris, the attempt of its revealing , based on ETS (external transcribed spacer) has been made. The ETS region, located between 18S and 26S of nuclear
ribosomal DNA was sequenced in 10 representatives of P. palustris and one sample of P.
nemoralis in order to evaluate their genetic similarity. Since the ETS region of P. nemoralis had already been investigated, our search was concentrated on P. palustris.
The resulting ETS matrix contains the 570 base pairs. Comparison of the nucleotide
sequences has showed a high similarity of ETS areas of P. nemoralis and P. palustris,
however, some differences, implicit and explicit, has been revealed. Obvious differences
were found in positions of nucleotides 44, 537, 538 and 562. Basically there were transitions. In one case the transversion was reported at position 538. In this position in
P. nemoralis was R, which may mean adenine or guanine, whereas all P. palustris had
cytosine at this area. Finally in position 44 in P. nemoralis was found deletion, whereas
P. palustris had adenine. Position 136 is quite interesting as well: P. nemoralis has cytosine here, the samples 3, 5, 7 of P. palustris shows an adenine in this position, whereas
in the other samples this position falls out as a whole, ie both transversion and deletion
take place. Some implicit differences were found as well. Thus, in position 43 P. palustris
had cytosine, whereas P. nemoralis – M, that may mean both cytosine, and thymine; in
position 161 P. palustris had guanine, whereas P. nemoralis – S, which may mean both
guanine and cytosine. Nevertheless, these seem to be the mistakes of identification of
nucleotides, and, in general, such comparisons are not quite proper, because P. nemoralis
was represented by only one sample, however, it may give a notion on the genetic similarity between species. Comparison of our data with ones, obtained from GenBank, has
confirmed the close genetic similarity of P. palustris, not only with P. nemoralis, but also
with P. glauca, with P. laxa subsp. flexuosa (Sm.) Hyl., (which is supposed to be derived
from the hybridization P. laxa and P. glauca), and even with P. lettermanii Vasey (sect.
Abbreviatae Nannf. еx Tzvel.). Тhe search has revealed the weak variability of this region.
The studies have shown that ETS region has proved to be too conservative for the investigation of relationships between quite close species of Stenopoa. Thus, other methods
should be tried for this purpose.
Key words: ETS; Poa nemoralis L.; Роа palustris L.
Received August 3, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 66–79
ЗООЛОГИЯ
УДК 598.2: 574.34: 571.5
А.А. Ананин
Государственный природный биосферный заповедник «Баргузинский» (г. Улан-Удэ)
ВЛИЯНИЕ ФЕНОЛОГИЧЕСКИХ СРОКОВ ВЕСНЫ
НА ФОРМИРОВАНИЕ ГНЕЗДОВОГО НАСЕЛЕНИЯ ПТИЦ
В ЛАНДШАФТНО-ЗОНАЛЬНЫХ УСЛОВИЯХ ГОР
СЕВЕРО-ВОСТОЧНОГО ПРИБАЙКАЛЬЯ
Исследовано влияние изменчивости фенологических сроков весны и индексов
теплообеспеченности весеннего периода на гнездовое обилие на примере 7 дальних мигрантов и 5 оседлых видов птиц. Динамика численности летнего населения
изучалась на постоянных маршрутах на высотных трансектах (1984–2007 гг.).
Выяснено, что метеорологические условия апреля и мая воздействуют на процессы формирования местного населения за счет изменения обилия массовых видов.
У зимующих пернатых гнездовое обилие меньше связано со сроками наступления
весенних субсезонов и параметрами теплообеспеченности территории в апреле – мае, и они лишь в незначительной степени влияют на формирование местного населения. Мигрирующие виды в большей степени зависимы от хода весенних
фенологических процессов и параметров теплообеспеченности района гнездования в год наблюдений. Сроки прохождения весенних фенофаз и особенности теплообеспеченности весеннего сезона могут оказывать существенное влияние на
специфику формирования местного населения и вызывают разнонаправленные
изменения обилия мигрирующих и зимующих видов. Наступление сроков весенних
субсезонов можно использовать в качестве индикаторов готовности местообитаний обеспечить птиц доступными кормовыми и гнездопригодными ресурсами.
Ключевые слова: птицы; гнездовое обилие; динамика обилия; фенофазы;
весенние фенологические индикаторы.
Введение
Изучение долговременных изменений численности популяций животных в природных условиях, несмотря на длительную историю исследований проблемы, по-прежнему не утратило своей актуальности. Особая
значимость таких работ связана с глобальным изменением климата и современными тенденциями роста воздействия антропогенных факторов. Как
известно, длительные стационарные наблюдения за численностью вида позволяют выявить особенности его реагирования на те или иные изменения
условий среды, в частности на теплообеспеченность в конкретном году. Во-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние фенологических сроков весны
67
вторых, Прибайкалье – место, где ход весны по годам заметно различается.
Удобной моделью для такого рода исследований во времени и пространстве
являются птицы.
Весенняя погода, которая определяет весь ход фенологического развития
природы, как прямо, так и опосредованно воздействует на сроки и динамику
многих биологических явлений в годовом цикле птиц [1–3]. Ход апрельских
и майских температур воздуха отражает общий процесс весеннего потепления, наступления сроков весенних субсезонов, которые в свою очередь
могут выступать индикаторами состояния природных комплексов. В свою
очередь наступление сроков весенних субсезонов определяет возможности
этих природных комплексов в конкретные моменты времени обеспечить
птиц доступными кормовыми и гнездопригодными ресурсами. Известно,
что даты прилета в область гнездования в высоких широтах зависят от характера весны и довольно сильно варьируют как у ближних, так и дальних
мигрантов [4–13]. В холодные весны птицы задерживаются на трассе пролета, и часто их появление в районе размножения наступает обычно в более
поздние сроки [7]. Так, обнаружилась прямая связь плотности населения
мухоловки-пеструшки в Карелии со среднемесячной температурой в мае
[14], и обилие вида в гнездовой период зависело от погоды в период прилета – начала гнездования. В теплые весны численность птиц оказывалась
выше, чем в холодные. Ранее на разных видах было показано, что в крайних
северных зонах ареалов флуктуации численности могут быть связаны с погодой: в холодные весны птицы не долетают до таких территорий и размножаются южнее, где наблюдается рост плотности населения [1, 3, 15, 16] по
сравнению с обычной весной. Справедливо полагать, что на изменения гнездового обилия птиц оказывает влияние комплекс разнообразных факторов,
включающий помимо местных условий также и ситуации на пролетных путях и зимовках, специфику генетической и возрастной структуры и другие
популяционные параметры. В связи с этим значительный интерес вызывают
особенности формирования населения группы неперелетных видов.
Целью наших исследований была проверка гипотезы влияния теплообеспеченности и фенологических сроков весеннего развития природы на
обилие местного населения птиц в условиях западного макросклона Баргузинского хребта.
Материалы и методики исследования
В качестве ключевого участка для долговременного орнитологического
мониторинга была использована модельная для региона территория государственного природного биосферного заповедника «Баргузинский» [17–20],
который расположен в центральной части западного склона Баргузинского
хребта и простирается с севера на юг вдоль северо-восточного побережья
Байкала. Западный склон хребта обращен к озеру и имеет особый и влажный
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
68
А.А. Ананин
прибайкальский тип поясности [21]. Он отличается на берегу Байкала снижением пояса по высоте подгольцовой растительности, отсутствием лесостепной
полосы, распространением лиственничных лесов лишь в нижних частях гор и
широким развитием высокогорных лугов и пустошей. Здесь выделяются 5 высотных поясов: прибайкальские террасы (расположены между озером Байкал
и подножием гор) с абсолютными высотами 460–520 м над ур. м.; предгорье –
нижняя часть горно-лесного пояса (520–630 м над ур. м.); горно-лесной пояс
(630–1 200 м над ур. м.), подгольцово-субальпийский (1 200–1 400 м над ур. м.)
и гольцово-альпийский пояс (1 400–2 800 м над ур. м.).
Характерно, что постоянные учетные маршруты по оценке обилия птиц
в рамках этой поясности располагались в ненарушенных человеком местах,
и поэтому ключевой участок максимально отражает в чистом виде условия,
связанные только с природными явлениями и климатическими изменениями
без антропогенных усугублений.
Изменения обилия летнего населения птиц изучались с 1984 по 2007 г.
Учеты птиц проводились на постоянных маршрутах, расположенных в долинах трех рек от побережья оз. Байкал до высокогорий Баргузинского хребта (460–1 700 м над ур. м.). На этих трансектах (Е, Б, Д) ключевого участка,
состоящих из 11 выделов, представлена большая часть разнообразия местообитаний нижней и верхней частей горно-лесного и подгольцово-субальпийского поясов [19].
Маршрут по долине р. Езовка (∑-Е) общей протяженностью 35,4 км
включал три выдела:
I – прибрежно-равнинный (ПР-Е) (протяженность 10,6 км, перепад высот
460–470 м над ур. м.),
II – предгорный (ПГ-Е) (13,2 км, 470–615 м над ур. м.),
III – горно-лесной (ГЛ-Е) (11,6 км, 615–1 150 м над ур. м.).
Маршрут по долине р. Большая (∑-Б) общей протяженностью 41,9 км
включал четыре выдела:
I – прибрежно-равнинный (ПР-Б) (10,8 км, 460–520 м над ур. м.),
II – равнинный (РА-Б) (8,9 км, 520–560 м над ур. м.),
III – равнинно-моренный (РМ-Б) (10,7 км, 560–580 м над ур. м.),
IV – предгорный (ПГ-Б) (11,5 км, 580–630 м над ур. м.).
Маршрут по долине р. Давша (∑-Д) длиной 27,3 км также имел четыре
выдела:
I – прибрежно-равнинный (ПР-Д) (10,3 км, 470–515 м над ур. м.),
II – предгорный (ПГ-Д) (6,3 км, 515–720 м над ур. м.),
III – горно-лесной (ГЛ-Д) (6,7 км, 720–1 280 м над ур. м.),
IV – подгольцово-субальпийский (ПС-Д) (4,0 км, 1 280–1 700 м над
ур. м.). В таблицах обозначения выделов приведены в соответствии с представленными сокращениями.
Общая протяженность пеших маршрутных учетов в первую половину
лета составила 5 552 км. Обилие птиц рассчитано по методу Ю.С. Равкина
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние фенологических сроков весны
69
[22]. Видовая классификация птиц принята по Л.С. Степаняну [23]. Статистическая обработка данных проведена с помощью пакета прикладных программ StatSoft STATISTICA 6.0. с учетом методических рекомендаций, предложенных для анализа временных рядов данных [24]. Использованы методы
непараметрической статистики. Для оценки силы связи применен ранговый
коэффициент корреляции Кендалла (rτ) [25].
Фенологические сроки весны в период наблюдений устанавливались с
использованием методики ведения «Календаря природы» в Баргузинском
заповеднике [26, 27]. «Календарь природы» является одним из наиболее традиционных разделов «Летописи природы», имеющих долговременные ряды
наблюдений, выполняется в заповеднике с 1938 г. В течение длительного
времени неизменными являлись места и методики наблюдений ряда весенних фенологических явлений, что позволяет произвести анализ динамики
их изменчивости. Основные фенологические исследования выполняются в
прибрежной зоне «ядра» биосферного заповедника, причем подавляющее
большинство наблюдений сделано в окрестностях пос. Давша.
Деление фенологического года на сезоны и субсезоны, установленное
К.П. Филоновым [26], применяется в Баргузинском заповеднике и поныне.
Внутри сезонов выделяются субсезоны, характеризующиеся сопутствующим комплексом феноявлений. Сроки наступления субсезонов определяются по климатическим параметрам, и их названия обычно отражают состояние
местообитаний птиц. Несмотря на значительную изменчивость сроков наступления и продолжительности сезонов и субсезонов, их различия характеризуют феноиндикаторы, которые и определяют их рубежи. Всего весенний
сезон подразделяется на четыре субсезона. Субсезон «снежная весна» наступает при относительно устойчивом переходе максимальных температур
воздуха выше 0°С, «пестрая» – при окончательном переходе максимальных
температур воздуха выше 0°С, «голая» – в сроки относительно устойчивого
перехода среднесуточных температур воздуха выше 0°С и «зеленая» весна –
при окончательном переходе максимальных температур воздуха выше 10°С.
Кроме дат наступления этих субсезонов проанализированы в качестве модельных следующие феноиндикаторы, т.е. явления, регулярно совпадающие
с началом или окончанием весенних субсезонов: это начало уменьшения высоты снежного покрова, сроки полного схода снега на открытых местах на
побережья оз. Байкал. В качестве индексов теплообеспеченности использованы суммы активных температур выше 0, +5 и +10ºС за апрель, май, июнь,
апрель – май и апрель – июнь текущего года.
В качестве моделей для оценки влияния сроков весны на гнездовое
обилие выбраны 12 видов птиц с максимальным для ключевого участка среднемноголетним обилием: 5 видов оседлых птиц – рябчик (Tetrastes
bonasia L.), пестрый дятел (Dendrocopos major L.), буроголовая гаичка
(Parus montanus Bald.), московка (Parus ater L.) и обыкновенный поползень
(Sitta europaea L.); 7 видов перелетных птиц – горная трясогузка (Motacilla
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
А.А. Ананин
70
cinerea Tunst.), пятнистый конек (Anthus hodgsoni Rich.), пеночка-зарничка
(Phylloscopus inornatus Blyth), зеленая пеночка (Ph. trochiloides Sund.), корольковая пеночка (Ph. proregulus Pall.), синехвостка (Tarsiger cyanurus Pall.)
и чиж (Spinus spinus L.).
Результаты исследования и обсуждение
Суммы активных температур выше 0°С в апреле, мае и апреле – мае
тесно связаны с датами наступления субсезонов «снежной», «пестрой» и
«голой» весны, а также сроками начала и полного схода снегового покрова на открытых местах (табл. 1). Суммы активных температур выше +5°С
в апреле отрицательно коррелируют со сроками прихода «голой» весны и
начала уменьшения высоты снегового покрова, а в мае – с датами начала
«снежной» и «зеленой» весны. Суммы активных температур выше +10°С
мая тесно связаны только с датами наступления «зеленой» весны.
Таблица 1
Связь индексов теплообеспеченности со сроками начала весенних субсезонов
и весенними феноиндикаторами (*p < 0,05; **p < 0,01)
Сумма активных
температур
Выше 0°С в апреле
Выше 0°С в мае
Выше 0°С в апреле
и мае
Выше +5°С в апреле
Выше +5°С в мае
Выше +5°С в апреле
и мае
Выше +10°С в мае
Фенофазы весны
Снежный покров
«снежная» «пестрая» «голая» «зеленая» Начало схода Сход
–0,30*
–0,40** –0,44**
+0,04
–0,29*
–0,31*
–0,36*
–0,30*
–0,27
–0,27
–0,23
–0,26
–0,44**
–0,15
–0,30*
–0,31*
–0,25
–0,40**
–0,52** –0,43**
–0,22
–0,28
–0,43**
–0,12
–0,04
–0,31*
–0,42**
–0,23
–0,20
–0,19
–0,41**
–0,32*
–0,19
–0,24
–0,26
–0,18
–0,27
+0,10
+0,21
–0,33*
+0,09
–0,04
Проанализировано влияние межгодовых отличий индексов теплообеспеченности на распределение обилия модельных видов птиц на вертикальном
экологическом профиле и между долинами рек, которые отличаются гидротермическим режимом (табл. 2), а также дана оценка связи гнездовой плотности этих видов со сроками наступления весенних субсезонов и датами
регистрации выбранных феноиндикаторов (табл. 3).
Рябчик. Гнездовое обилие рябчика в долине р. Давша возрастает в сезоны с
ранним началом уменьшения снегового покрова (rτ = –0,54; p < 0,01) и ранними
датами наступления фенофазы «голая» весна (rτ = –0,57; p < 0,01). На предгорном участке долины р. Давша – также в годы с более ранними сроками начала
уменьшения снегового покрова (rτ = –0,45; p < 0,05) и схода снега на открытых
участках на побережье Байкала (rτ = –0,45; p < 0,05). Снижение плотности весеннего населения вида в горно-лесном выделе р. Езовка отмечено в сезоны с
ранними датами прихода «зеленой» весны (rτ = 0,51; p < 0,05) (табл. 3).
С суммами активных температур выше 0°С в апреле и мае обнаружена
положительная связь обилия вида в долине р. Давша (rτ = 0,45; p < 0,05 и
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние фенологических сроков весны
71
rτ = 0,51; p < 0,05), так же как и с суммами активных температур выше +5°С в
апреле, а в мае – с обилием на равнинно-моренном участке долины р. Большая (rτ = 0,43; p < 0,05). Суммы активных температур выше +10°С в мае отрицательно связаны с обилием на прибрежно-равнинном участке долины
р. Большая (rτ = –0,58; p < 0,01) и проявляют негативную тенденцию связи с
обилием рябчиков в долине р. Езовка (rτ = –0,38, ns.) (табл. 2).
Связь гнездового обилия птиц по выделам с индексами
теплообеспеченности (p < 0,05, **p < 0,01)
Вид
Sitta europaea
Parus ater
Суммы активных температур выше
+5ºС
Апрель +
Апрель +
Май
Апрель
Май
май
май
–
–
–
–
–
РМ-Б(–)*
∑-Е(+)*
ПР-Е(+)*
0ºС
Апрель
–
Parus montanus
ПР-Б(+)*
Phylloscopus
ПГ-Д(+)*
ПР-Е(+)*
proregulus
Tarsiger
cyanurus
Anthus
hodgsoni
Таблица 2
+10ºС
Май
–
ПГ-Б(+)*
ПР-Б(+)* ПГ-Д(+)** ПГ-Д(+)** ПГ-Д(+)**
∑-Е(+)*
ПР-Е(+)* ПР-Е(+)*
ПР-Е(+)*
ПР-Е(+)*
ПР-Е(+)**
ПГ-Е(+)*
ГЛ-Е(+)** ПГ-Е(+)*
ПГ-Б(–)*
ПГ-Е(+)*
ПГ-Е(+)*
∑-Б(–)* ∑-Б(–)*
ПР-Б(–)* ПР-Б(–)**
ПР-Б(–)*
ПР-Б(–)* ПР-Б(–)*
∑-Е(+)** ∑-Е(+)* ПГ-Д(-)*
ПГ-Д(–)*
∑-Е(+)* ∑-Е(+)*
ПР-Е(+)** ПР-Е(+)**
ПР-Е(+)* ПР-Е(+)*
–
–
–
–
–
–
∑-Б(+)* ∑-Б(+)* ПГ-Б(+)*
∑-Б(+)*
ПР-Е(+)**
∑-Б(+)*
ПГ-Б(+)* ПГ-Б(+)* ПР-Е(+)*
ПГ-Б(+)*
∑-Е(+)*
ГЛ-Е(+)*
–
Spinus spinus
Phylloscopus
trochiloides
Phylloscopus
inornatus
Tetrastes
∑-Д(+)* ∑ Д(+)* ∑-Д(+)* ∑-Д(+)* РМ-Б(+)* РМ-Б(+)* ПР-Б(–)**
bonasia
Motacilla
ПР-Е(–)*
ПС-Д(–)*
cinerea
Dendrocopos
ПГ-Б(+)* ПР-Е(+)**
ПГ-Б(+)* ПР-Е(+)** ПР-Е(+)**
major
Примечание. (+) – корреляция положительная; (–) – корреляция отрицательная.
Пестрый дятел. При ранних сроках наступления снежной весны гнездовая численность дятла возрастает в долине р. Давша (rτ = –0,42; p < 0,05),
на ее прибрежно-равнинном (rτ = –0,43; p < 0,05) и предгорном (rτ = –0,50;
p < 0,05) участках. Снижение обилия вида зарегистрировано в предгорном
выделе р. Езовка в годы с ранними сроками схода снега на побережье Байкала (rτ = 0,44; p < 0,05) (табл. 3).
Суммы активных температур выше 0°С и выше +5°С в апреле положительно связаны с гнездовой численностью вида на предгорном участке долины р. Большая (rτ = 0,48; p < 0,05), в мае – с видовым обилием в прибрежно-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
А.А. Ананин
72
равнинном выделе долины р. Езовка (rτ = 0,55; p < 0,01), а в апреле – мае – на
прибрежно-равнинном участке р. Давша (rτ = 0,42; p < 0,05). Суммы активных температур выше +10°С, напротив, отрицательно коррелируют с численностью пестрых дятлов в долине р. Большая (rτ = –0,50; p < 0,05) и в ее
прибрежно-равнинном (rτ = –0,43; p < 0,05) и равнинно-моренном (rτ = –0,48;
p < 0,05) выделах (см. табл. 2).
Таблица 3
Связь гнездового обилия модельных видов птиц со сроками начала весенних
субсезонов и весенними феноиндикаторами (*p < 0,05, **p < 0,01)
Снежный покров
Начало
«снежная» «пестрая» «голая» «зеленая»
Сход
схода
ПР-Б(+)*
ПР-Б(+)*
Sitta europaea
ПГ-Б(+)*
∑-Б(+)**
∑-Д(+)* РА-Б(+)**
Parus ater
ПГ-Б(+)*
ПГ-Д(–)*
ГЛ-Д(–)*
Parus montanus
ПР-Б(–)*
∑-Д(–)*
Phylloscopus
ПР-Е(–)*
ПР-Б(–)*
proregulus
ПГ-Д(–)*
КУ(–)*
КУ(–)*
ПГ-Б(+)*
ПР-Е(–)*
∑-Б(–)*
∑-Е(–)*
ПР-Е(–)*
∑-Е(–)*
ГЛ-Е(–)*
Tarsiger cyanurus
РМ-Б(–)* ПР-Е(–)*
ПГ-Е(–)*
ПР-Е(–)**
ПГ-Д(–)*
ПГ-Е(–)*
∑-Б(+)*
∑-Б(+)*
ПР-Б(+)*
ПГ-Б(+)* ПР-Б(+)**
Anthus hodgsoni
ПР-Б(+)*
∑-Е(–)*
РА-Б(+)*
∑-Д (+)*
Spinus spinus
ПС-Д (+)**
∑-Б(–)*
Phylloscopus
ПР-Б(–)*
ПГ-Е(+)*
∑-Е(–)**
ПГ-Б(–)*
trochiloides
КУ(–)*
Phylloscopus inorПГ-Е(–)*
ПР-Б(–)* ПГ-Б(+)*
natus
ПР-Д(–)*
∑-Д(–)**
∑-Д(–)* ГЛ-Е(+)**
ПГ-Д(–)*
Tetrastes bonasia
ПГ-Д(–)*
РА-Б(+)**
ПР-Д(–)**
Motacilla cinerea
ПР-Д(–)*
∑-Д(–)*
ПГ-Е(+)*
Dendrocopos major ПР-Д(–)*
ПГ-Д(–)*
Примечание. (+) – корреляция положительная; (–) – корреляция отрицательная.
Вид
Фенофазы весны
Буроголовая гаичка. Гнездовое обилие вида повышается при более
ранних сроках прихода «снежной» весны на предгорном участке р. Давша
(rτ = –0,51; p < 0,05), а при ранней «зеленой» весне – в горно-лесном выделе
р. Давша (rτ = –0,46; p < 0,05). При повышении суммы активных температур
выше +10°С в мае численность гаички на предгорном участке р. Большая
снижается (rτ = 0,44; p < 0,05).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние фенологических сроков весны
73
Московка. Обилие московки снижается при более ранних сроках прихода «голой» весны на равнинном (rτ = 0,54; p < 0,01), предгорном (rτ = 0,42;
p < 0,05) выделах и по всей долине р. Большая (rτ = 0,56; p < 0,01), а также при
ранней «пестрой» весне – в долине р. Давша (rτ = 0,43; p < 0,05).
Суммы активных температур выше +5°С в апреле отрицательно связаны с численностью на равнинно-моренном участке р. Большая (rτ = –0,44;
p < 0,05) и положительно – с обилием на прибрежно-равнинном участке
(rτ = 0,48; p < 0,05) и по всей долине р. Езовка (rτ = 0,48; p < 0,05). Суммы активных температур выше +10°С в мае – июне сопровождаются повышением
обилия вида во всей долине р. Давша (rτ = 0,44; p < 0,05).
Обыкновенный поползень. Возрастание гнездовой численности вида
выявлено на прибрежно-равнинном (rτ = 0,43; p < 0,05) и предгорном (rτ =
= 0,48; p < 0,05) участках р. Большая при ранних сроках начала уменьшения
снегового покрова и прихода «голой» весны. Гнездовая плотность поползня во всех выделах ключевого участка статистически не связана с суммами
активных температур текущего года. В то же время обнаруживаются отрицательные корреляции суммы активных температур выше 0°С в мае предыдущего года с гнездовым обилием вида в текущем году на территории всего
ключевого участка (rτ = –0,47; p < 0,05), в долинах всех трех рек и на их отдельных выделах (p < 0,05).
Горная трясогузка. Наблюдается увеличение численности вида на прибрежно-равнинном участке р. Давша в годы с более ранними сроками прихода «снежной» весны (rτ = –0,42; p < 0,05), наступлением «пестрой» весны (rτ = –0,44; p < 0,05) и сходом снега на открытых местах на побережье
оз. Байкал (rτ = –0,52; p < 0,05). На равнинном выделе р. Большая (rτ = 0,55;
p < 0,01) такая же зависимость прослеживается в годы с поздним приходом
«пестрой» весны, а на ее прибрежно-равнинном участке (rτ = 0,43; p < 0,05) –
в годы с поздней регистрацией субсезона «голая весна».
Суммы активных температур выше 0°С в апреле выявляют отрицательную
корреляцию с обилием вида на прибрежно-равнинном участке долины р. Езовка (rτ = –0,50; p < 0,05), а в апреле – мае – с видовой плотностью в подгольцово-субальпийском выделе р. Давша (rτ = –0,46; p < 0,05). Суммы активных
температур выше +10°С в июне отрицательно коррелируют с гнездовым обилием трясогузки на всем ключевом участке (rτ = –0,44; p < 0,05), в горно-лесном
(rτ = 0,45; p < 0,05) и подгольцово-субальпийском (rτ = –0,43; p < 0,05) выделах
р. Давша, на равнинно-моренном участке р. Большая (rτ = –0,53; p < 0,05).
Пятнистый конек. Увеличение гнездовой численности вида отмечается
на прибрежно-равнинном (rτ = 0,50; p < 0,05) и равнинном (rτ = 0,55; p < 0,01)
выделах долины р. Большая в годы с ранними сроками прихода «пестрой»
весны, в долине р. Большая (rτ = 0,54; p < 0,01) и на ее прибрежно-равнинном
участке (rτ = 0,49; p < 0,05) – в периоды с ранними регистрациями субсезона «голая весна», на прибрежно-равнинном выделе этой долины (rτ = 0,44;
p < 0,05) – в годы с ранними датами прихода «снежной» весны, а на предгор-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
74
А.А. Ананин
ном участке р. Большая (rτ = 0,51; p < 0,05) – с относительно более ранними
сроками начала «снежной» весны. Снижение обилия вида регистрируется
в долине р. Езовка в сезоны с ранним сходом снега на побережье Байкала
(rτ = –0,51; p < 0,05). Обилие конька в долине р. Давша негативно связано
со сроками прихода «голой» весны (rτ = –0,46, p < 0,05), а на ее прибрежноравнинном участке – с датами регистрации «пестрой» (rτ = –0,42; p < 0,05) и
«голой» (rτ = –0,42; p < 0,05) весны (см. табл. 3).
Суммы активных температур выше 0°С в апреле и мае обнаруживают отрицательную связь с численностью на прибрежно-равнинном участке долины
р. Большая (rτ = –0,43, p < 0,05; rτ = –0,44, p < 0,05), в апреле – на предгорном
выделе р. Давша (rτ = –0,42; p < 0,05), в мае – положительно коррелируют с
обилием вида в долине р. Езовка (rτ = 0,55; p < 0,01) и на ее прибрежно-равнинном участке (rτ= 0,55; p < 0,01). Суммы активных температур выше +5°С в мае
дополнительно отрицательно связаны с численностью пятнистых коньков в
долине р. Большая (rτ = –0,43; p < 0,05). С суммами активных температур выше
+10°С статистически значимые корреляции не выявлены (см. табл. 2).
Пеночка-зарничка. Возрастание численности вида в периоды с ранними сроками наступления «снежной» весны обнаружено на всем ключевом
участке (rτ = –0,43; p < 0,05), на прибрежно-равнинном выделе р. Давша
(rτ = –0,43; p < 0,05) и на предгорном участке р. Езовка (rτ = –0,42; p < 0,05).
Обилие вида на прибрежно-равнинном участке р. Большая увеличивается в
годы с ранними сроками прихода «пестрой» (rτ = –0,43; p < 0,05) и «зеленой»
(rτ = = –0,45; p < 0,05) весны. Положительная связь отмечена между численностью на предгорном, наиболее удаленном от побережья оз. Байкал, выделе р. Большая и датами начала уменьшения снегового покрова на побережье
(rτ = 0,46; p < 0,05). Суммы активных температур выше 0°С в июне текущего
года положительно связаны с обилием зарнички в долине р. Езовка (rτ = 0,48;
p < 0,05) и на ее горно-лесном участке (rτ = 0,42; p < 0,05).
Зеленая пеночка. Увеличение плотности видового населения в годы с
ранними датами начала уменьшения снегового покрова наблюдалось на
всем ключевом участке (rτ = –0,42; p < 0,05), в долине р. Большая (rτ = –0,47;
p < 0,05) и в ее предгорном выделе (rτ = –0,50; p < 0,05), в периоды с ранним приходом «снежной» весны – на прибрежно-равнинном участке долины р. Большая (rτ = –0,50; p < 0,05), с ранними сроками полного схода снега
на открытых местах на побережье оз. Байкал – в долине р. Езовка (rτ = –0,47;
p < 0,05). Положительная корреляция зарегистрирована между датами прихода «зеленой» весны и гнездовым обилием вида в предгорном выделе
р. Езовки (rτ = 0,46; p < 0,05). Суммы активных температур выше 0°С в апреле положительно связаны с численностью на прибрежно-равнинном участке
р. Езовки (rτ = 0,57; p < 0,01), в мае – с обилием вида в долине р. Большой
(rτ = 0,50; p < 0,05) и на ее предгорном участке (rτ = 0,49; p < 0,05).
Корольковая пеночка. Обилие вида в долине р. Давша и на прибрежноравнинном участке р. Большая возрастает в годы с ранними датами начала
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние фенологических сроков весны
75
уменьшения высоты снежного покрова (p < 0,05), а в годы с ранними сроками прихода «голой» весны – на прибрежно-равнинных выделах р. Большая
и р. Езовка, а также на предгорном участке р. Давша (p < 0,05). Суммы активных температур выше 0°С в апреле положительно связаны с численностью вида на прибрежно-равнинных участках р. Большая (rτ = 0,42; p < 0,05)
и р. Езовка (rτ = 0,45; p < 0,05), а в мае – с обилием на предгорном участке
долины р. Давша (rτ = 0,48; p <0,05). Между суммами активных температур
выше +5°С в мае и гнездовой плотностью на предгорном участке долины
р. Давша также выявлена положительная корреляция (rτ= 0,59; p<0,01). Суммы активных температур выше 0°С и +5°С в июне отрицательно коррелируют с обилием пеночки на всем ключевом участке, в равнинном и равнинноморенном выделах р. Большая, а также во всей долине р. Большая (p < 0,05).
Синехвостка. Увеличение численности вида обнаруживается в годы с
ранними сроками наступления «снежной» весны на всем ключевом участке
(rτ = –0,46; p < 0,05), на прибрежно-равнинном (rτ = –0,48; p < 0,05) и предгорном (rτ = –0,60; p < 0,01) выделах долины р. Езовка, в периоды с ранними датами начала уменьшения снегового покрова – в долине р. Езовка
(rτ = –0,48; p < 0,05), с ранними сроками прихода «голой» весны – на прибрежно-равнинном участке долины р. Езовка (rτ = –0,52; p < 0,05), а в годы с
ранней регистрацией субсезона «зеленая весна» – на всем ключевом участке
(rτ = = –0,49; p < 0,05), в долине р. Большая и на ее удаленных от побережья
Байкала равнинно-моренном и предгорном участках, на предгорном выделе
р. Езовка и на прибрежно-равнинном участке р. Давша (p < 0,05).
Суммы активных температур выше 0°С в апреле положительно коррелируют с гнездовой плотностью вида на прибрежно-равнинном (rτ = 0,47;
p < 0,05) и горно-лесном (rτ = 0,55; p < 0,01) участках р. Езовка, в мае – на
прибрежно-равнинном (rτ = 0,47; p < 0,05) и предгорном (rτ = 0,43; p < 0,05)
выделах этой долины, в июне – на предгорном участке р. Давша (rτ = 0,44;
p < 0,05), а в апреле – мае – во всех выделах долины р. Езовка (p<0,05).
Суммы активных температур выше +5°С в апреле отрицательно связаны с
обилием синехвостки на предгорном участке долины р. Большая (rτ = –0,46;
p < 0,05) и положительно – на прибрежно-равнинном участке р. Езовка
(rτ = 0,46; p < 0,05), а в мае – положительно на предгорном выделе этой долины (rτ = 0,42; p < 0,05). Суммы активных температур выше +10°С в июне
выявляют позитивную связь с численностью вида на предгорном участке
долины р. Давша (rτ = 0,45; p < 0,05).
Чиж. Гнездовое обилие вида по всей долине р. Давша и в ее верховьях
обнаруживает положительную корреляцию с датой начала «снежной» весны (rτ = 0,48; p < 0,05 и rτ = 0,55; p < 0,01). В целом, чем позднее весна, тем
выше гнездовая плотность чижа в верхних и наиболее удаленных от Байкала участках (в долине р. Большая – в предгорном, а в долине р. Давша – в
горно-лесном выделе). Не выявлена статистически значимая связь видового
обилия с индексами теплообеспеченности весны текущего года.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
76
А.А. Ананин
Заключение
Для таких оседлых видов, как рябчик и буроголовая гаичка, выявлено повышение гнездовой плотности в годы с более ранними сроками наступления
весны. Связи обилия московки с фенологическими сроками весны имеют
противоположный характер: ее численность во многих выделах выше в годы
с поздней весной. Изменения плотности гнездования поползня и пестрого дятла не связаны со сроками наступления весенних субсезонов. В то же
время для рябчика и пестрого дятла на отдельных участках выявляется положительная связь обилия с индексами теплообеспеченности апреля и мая,
которая практически отсутствует у буроголовой гаички и поползня. В целом
зимующие виды имеют значительно меньшие связи гнездового обилия со
сроками наступления весенних субсезонов и параметрами теплообеспеченности территории в апреле – мае, которые лишь в незначительной степени
влияют на формирование населения. Процессы формирования гнездового
населения оседлых видов реализуются преимущественно в ходе позднелетних и осенних перемещений и кочевок.
Мигрирующие виды птиц в значительно большей степени связаны с ходом весенних фенологических процессов и индексами теплообеспеченности района гнездования в год наблюдений. Для всех включенных в анализ
перелетных видов, за исключением чижа, характерно повышение гнездовой
плотности в годы с более ранними сроками прохождения весенних фенофаз.
В то же время для горной трясогузки и пятнистого конька отмечаются разнонаправленные связи численности в различных высотных выделах ключевого участка со сроками наступления «пестрой» и «голой» весны, что определяется отмечаемыми для этих видов высотно-зональными и междолинными
перераспределениями обилия.
Для чижа более характерно повышение гнездовой плотности в годы с
поздней весной, что, возможно, определяется «недолетом» части мигрирующей через район исследований популяции до лежащих севернее территорий
и ее «оседанием» для гнездования в южной части гнездового ареала.
С параметрами теплообеспеченности у горной трясогузки и пятнистого
конька выявляются в основном негативные корреляционные связи. Обилие
горных трясогузок в подгольцово-субальпийском выделе снижается в более
теплые весны, а для пятнистого конька в разные по теплообеспеченности
годы отмечается перераспределение гнездовой плотности между долинами
соседних рек. У синехвостки, корольковой и зеленой пеночек преобладают
позитивные связи с суммами активных температур, в теплые весны численность этих видов возрастает. Обилие синехвосток вблизи побережья оз. Байкал в условиях лучшей теплообеспеченности возрастает, а на значительном
удалении от него (свыше 25–30 км) имеет противоположно направленную
зависимость. Для чижа и пеночки-зарнички статистически значимые связи
с индексами теплообеспеченности апреля и мая не выявлены, хотя повыше-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние фенологических сроков весны
77
ние суммы активных температур выше 0°С в июне сопровождается ростом
гнездовой плотности пеночки-зарнички в горно-лесном поясе наиболее «холодной» долины р. Езовка. Такому же повышению теплообеспеченности
июня сопутствует повсеместное снижение обилия корольковой пеночки.
Таким образом, весенняя погода как прямо, так и через развитие фенологических процессов в биоценозе влияет на динамику многих биологических явлений в годовом цикле птиц. В Северо-Восточном Прибайкалье
метеорологические условия апреля и мая определяют не только сроки прилета многих видов, но и воздействуют на процессы формирования местного
населения за счет изменения количества обосновавшихся в районе гнездования особей. Сроки прохождения весенних фенофаз и параметры теплообеспеченности весеннего сезона могут оказывать существенное влияние
на особенности формирования местного населения птиц, вызывая разнонаправленные изменения обилия мигрирующих и оседлых видов птиц в различных высотно-поясных выделах и соседних речных долинах, отличающихся по своим экологическим условиям.
Литература
1. Данилов Н.Н. Пути приспособления наземных позвоночных животных к условиям существования в Субарктике. Т. 2 : Птицы. Свердловск : Изд-во УФАН СССР, 1966. 148 с.
2. Järvinen A. Patterns and causes of longterm variation in reproductive traits of the Pied Flycatcher Ficedula hypoleuca in Finnish Lapland // Ornis Fennica. 1989. Vol. 66. P. 24–31.
3. Рябицев В.К. Территориальные отношения и динамика сообществ птиц в Субарктике.
Екатеринбург : Наука, 1993. 296 с.
4. Шульц Г.Э. Общая фенология. Л. : Наука, 1981. 188 с.
5. Москвитин С.С., Баяндин О.В. Общая характеристика видимого пролета птиц в пойме
Средней Оби // Экология наземных позвоночных Сибири. Томск : Изд-во Том. ун-та,
1983. С. 85–104.
6. Минин А.А. Пространственно-временная изменчивость дат начала некоторых фенологических явлений у птиц на Русской равнине // Бюллетень Московского общества
испытателей природы. Отд. биол. 1992. Т. 97, вып. 5. С. 28–34.
7. Соколов Л.В., Марковец М.Ю., Шаповал А.П., Морозов Ю.Г. Долговременный мониторинг сроков весенней миграции у воробьиных птиц на Куршской косе Балтийского
моря. 2. Влияние температурного фактора на сроки миграции // Зоологический журнал. 1999. Т. 78. Вып. 9. С. 1102–1109.
8. Sokolov L.V. Spring ambient temperature as in important factor controlling timing of arrival,
breeding, post fledging dispersal and breeding success of Pied Flycatcher Ficedula hypoleuca in Eastern Baltic // Avian Ecology and Behaviour. 2000. Vol. 5. P. 79–104.
9. Ананин А.А. Многолетняя динамика сроков весенних и осенних орнитофенологических явлений // Мониторинг природных комплексов Северо-Восточного Прибайкалья : тр. Гос. прир. биосф. заповедника «Баргузинский». Улан-Удэ : Изд-во БГУ, 2002.
Вып. 8. С. 104–138.
10. Ананин А.А. Влияние изменений климата на фенологию птиц в Баргузинском заповеднике // Многолетняя динамика численности птиц и млекопитающих в связи с глобальными изменениями климата : материалы междунар. симп. Казань : Новое знание,
2002. С. 107–112.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
78
А.А. Ананин
11. Ананин А.А. Долговременные изменения сроков весеннего прилета птиц на территории заповедника «Баргузинский» // Современные проблемы орнитологии Сибири и
Центральной Азии : материалы II Междунар. орнитол. конф. Улан-Удэ : Изд-во БГУ,
2003. Ч. 1. С. 143–147.
12. Ананин А.А. Влияние погодно-климатических изменений на сроки прилета и гнездовую плотность массовых видов птиц Баргузинского заповедника (Северо-Восточное
Прибайкалье) // Современные проблемы орнитологии Сибири и Центральной Азии.
Улан-Удэ : Изд-во БГУ, 2006. Вып. 3, ч. 1. С. 6–8.
13. Ананин А.А. Долговременные изменения сроков прилета птиц в Северо-Восточное
Прибайкалье // Сибирская орнитология / Вестник Бурятского университета. УланУдэ : Изд-во БГУ, 2006. Спец. серия. Вып. 4. С. 7–17.
14. Артемьев А.В. Влияние погоды на биологию гнездования мухоловки-пеструшки,
Ficedula hypoleuca (Passerifirmes, Muscicapidae), в Карелии // Зоологический журнал.
2002. Т. 81, № 7. С. 841–849.
15. Шутов С.В., Рябицев В.Н., Рыжановский В.Н. Ежегодное перераспределение пеночки-веснички и пеночки-таловки в северной части ареала // Вид и его продуктивность
в ареале : материалы 4-го Всесоюз. совещ. Свердловск, 1984. С. 89–90.
16. Головатин М.Г. Связь динамики населения воробьиных птиц Субарктики с изменением климатических условий // Актуальные проблемы изучения и охраны птиц Восточной Европы и Северной Азии : материалы Междунар. конф. (XI Орнитол. конф.).
Казань : Матбугат йорты, 2001. С. 180–181.
17. Ананин А.А. Многолетняя динамика численности летнего и зимнего населения птиц
Баргузинского заповедника // Достижения и проблемы орнитологии Северной Евразии на рубеже веков : тр. Междунар. конф. «Актуальные проблемы изучения и охраны
птиц Восточной Европы и Северной Евразии». Казань : Магариф, 2001. С. 295–316.
18. Ананин А.А. Долговременные исследования динамики численности птиц Баргузинского хребта // Развитие современной орнитологии в Северной Евразии : тр. XII Междунар. орнитол. конф. Северной Евразии. Ставрополь : Изд-во СГУ, 2006. С. 280–297.
19. Ананин А.А. Птицы Баргузинского заповедника. Улан-Удэ : Изд-во БГУ, 2006. 276 с.
20. Ананин А.А. Многолетняя динамика летнего населения птиц высокогорий Баргузинского хребта (Северо-Восточное Прибайкалье) // Известия Самарского научного центра РАН. 2009. Т. 11, № 1/1. С. 9–12.
21. Тюлина Л.Н. Особенности поясного распределения растительности // Природные условия северо-восточного Прибайкалья. Новосибирск : Наука, 1976. С. 30–43.
22. Равкин Ю.С. К методике учета птиц лесных ландшафтов // Природа очагов клещевого
энцефалита на Алтае. Новосибирск : Наука, 1967. С. 66–75.
23. Степанян Л.С. Конспект орнитологической фауны России и сопредельных территорий (в границах СССР как исторической области). М. : Академкнига, 2003. 808 с.
24. Коросов А.В. Специальные методы биометрии : учеб. пособ. Петрозаводск : Изд-во
ПетрГУ, 2007. 364 с.
25. Песенко Ю.А. Принципы и методы количественного анализа в фаунистических исследованиях. М. : Наука, 1982. 287 с.
26. Филонов К.П. Сезонное развитие природы в Баргузинском заповеднике // Природный
комплекс северо-восточного Прибайкалья : тр. Баргузин. гос. зап. Улан-Удэ, 1978.
Вып. 7. С. 47–67.
27. Федоров А.В., Ананин А.А. Долговременные изменения сроков регистрации феноявлений в «Календаре природы» Баргузинского заповедника // Мониторинг природных
комплексов Северо-Восточного Прибайкалья : тр. гос. прир. биосф. заповедника
«Баргузинский». Улан-Удэ : Изд-во БГУ, 2002. Вып. 8. С. 47–69.
Поступила в редакцию 07.12.2010 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние фенологических сроков весны
79
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 66–79
Alexander A. Ananin
State Nature Biosphere Reserve «Barguzinskiy», Ulan-Ude, Russia
THE INFLUENCE OF SPRING PHENOLOGICAL TERMS UPON FORMATION
OF THE BIRD NESTED POPULATION IN LANDSHAFT-ZONE
GRADIENT OF NORTH-EAST PRIBAIKALYE MOUNTAINS
The influence of variability of spring phenological terms and warmth indexes of
the spring period on a nested abundance on the example of 7 distant migrants and
5 settled species of birds is investigated. The dynamics of the number of the summer
population was studied in 1984–2007 on constant routes on high-rise transects (460–
1700 m a.s.l.). It is found out that meteorological factors of April and May influence
the processes of formation of local population by means of changing mass species
abundance. With wintering birds the nested abundance is connected with terms of
spring subseasons approach and less with warmth of territories in April-May. Its
influence upon local population formation is insignificant. Migrating species are
connected with the course of spring phenological processes and warmth nesting area
in a year of the supervision at greater degrees. For the majority of flying species of
the birds an increase in nested density in years with earlier terms of passage spring
phenological seasons is characteristic. For gray wagtail Motacilla cinerea and
olive-backed pipit Anthus hodgsoni in various high-rise belts connections of different
character between the number and the terms of spring phenological seasons approach
are marked. The increase of nested density in years with late spring at siskin Spinus
spinus is characteristic. It can be accounted for “falling short” of a part migrating
population to the northern territories and its “subsidence” for nesting in the southern
part of a nested area. The decrease in nested abundance in all belts during years with
warmer June is characteristic for Pallas’s warblers Phylloscopus proregulus while
migrating at the end of spring. It is the result of prolongation of spring flight in warm
spring and decrease in “subsidence” of species in a southern part of a nested area. The
terms of passage spring phonological seasons and spring warmth can make essential
impact on specificity of formation of local population. Moreover, they cause different
direct changes of the abundance of migrating and wintering species. The approach of
terms of spring subseasons can be used as indicators of readiness of habitats to provide
birds with accessible fodder and suitable habitats.
Key words: birds; dynamics of an abundance; spring phenological indicators,
meteorological factors.
Received December 7, 2010
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 80–91
УДК 591.526+591.551+595.78
А.О. Шкурихин, Т.С. Ослина, Е.Ю. Захарова
Институт экологии растений и животных УрО РАН (г. Екатеринбург)
ПРОТАНДРИЯ МОНО- И ПОЛИВОЛЬТИННЫХ ВИДОВ БЕЛЯНОК
И БАРХАТНИЦ (Lepidoptera, Pieridae, Satyridae) В УСЛОВИЯХ
ЮЖНО-УРАЛЬСКОЙ ЛЕСОСТЕПИ
Работа выполнена при финансовой поддержке РФФИ (грант № 11-04-00720)
и Президиума РАН (программа «Биологическое разнообразие» 12-С-4-103).
Проведен анализ сезонной динамики относительного обилия и соотношения
полов массовых видов в течение лёта имаго всех генераций с мая по сентябрь
2010 г. Наиболее массовыми в поздневесеннем периоде являлись огородные белянки Pieris napi и P. rapae, в раннелетнем – Coenonympha pamphilus, в первом
среднелетнем периоде – моновольтинные виды Aporia crataegi, Aphantopus hyperantus, Coenonympha glycerion. Во втором среднелетнем и позднелетнем периодах численно доминирует P. edusa, а также вновь возрастает относительное
обилие P. rapae. Статистически значимо подтверждено наличие протандрии
у моновольтинных видов (Aporia crataegi, Aphantopus hyperantus, Coenonympha
glycerion) и у бивольтинного вида с неперекрывающимися во времени генерациями (Сoenonympha pamphilus). Для поливольтинных видов белянок с перекрывающимися во времени генерациями (Pieris napi, P. rapae и Pontia edusa) характерна
тенденция более раннего вылета имаго самцов для первого, диапаузирующего
поколения, но протандрия статистически не подтверждена.
Ключевые слова: протандрия; динамика соотношения полов; генерация;
Pieridae; Satyridae.
Введение
Дневные бабочки являются одной из самых изученных групп насекомых
с точки зрения фаунистики и систематики. В течение последних десятилетий они стали объектами популяционной экологии, генетики, эволюционной биологии и ряда других дисциплин [1]. Особую задачу представляет
изучение сезонных аспектов населения булавоусых чешуекрылых. Для некоторых регионов России прослежены закономерности сезонной динамики
лёта как всего комплекса видов данной группы [2–5], так и отдельных видов,
например Pieris napi L. [6], Limenitis populi L. [7] и Erebia ligea L. [8].
Для сезонной динамики лета имаго у некоторых видов булавоусых чешуекрылых характерна протандрия, или более раннее появление самцов по
сравнению с самками. Наличие протандрии у разных групп беспозвоночных
и позвоночных животных, обитающих в разнообразных условиях, позволило сформулировать значительное количество гипотез, объясняющих адаптивность этого явления [9].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Протандрия моно- и поливольтинных видов белянок
81
Протандрия у булавоусых чешуекрылых связана с репродуктивной стратегией вида, половым диморфизмом размеров тела, типом жизненного цикла и многими другими биологическими особенностями [10–12]. Например,
у видов семейства Satyridae, репродуктивная стратегия которых подразумевает высокую степень моногамности самок, самцы с целью увеличения своего репродуктивного успеха вынуждены вылетать раньше, тем самым повышая свои шансы на оплодотворение самки [13].
У белянок (Pieridae) самки способны к многократному спариванию (полиандрии); их плодовитость прямо связана с количеством спариваний, так как самцы
вместе со сперматофором передают самке питательные вещества, необходимые
для развития яиц. В таком случае большее количество раз спарившаяся самка
будет откладывать больше жизнеспособных яиц. Поэтому самцам выгодно производить повышенное количество эякулята, а для этого они сами должны быть
крупнее и развиваться дольше [12]. Еще одним фактором, определяющим наличие протандрии у полиандричных видов белянок, является увеличение количества производимого эякулята с увеличением возраста самца. Таким образом,
в случае полиандричных белянок существует сложный баланс разнонаправленных процессов, поддерживающих некоторую степень протандрии.
Одной из важных характеристик жизненного цикла чешуекрылых является вольтинность, т.е. число генераций за сезон. В случае моновольтинного
жизненного цикла протандрия легко регистрируется как в лабораторных,
так и в природных условиях. Для ряда видов было показано, что если виду
свойственны две генерации в год (бивольтинный жизненный цикл), то протандрия имеет место как у поколения, развивающегося с диапаузой, так и у
недиапаузирующего поколения. Однако разность во времени вылета имаго
самцов и самок, как, например, в случае P. napi, может быть различной для
первой (1,4 дня) и второй (0,3 дня) генераций [1].
Обширная дискуссия в литературе посвящена в основном адаптивности явления протандрии. Число работ, посвященных исследованию протандрии нескольких видов одного сообщества, невелико. Поэтому актуально изучение протандрии моно- и полиандричных видов бабочек с различной вольтинностью,
совместно обитающих на одной территории в течение всего летнего сезона.
Цель настоящей работы – анализ сезонной динамики относительного
обилия самцов и самок в ходе лёта генераций у моно- и поливольтинных
видов белянок и бархатниц.
Материалы и методики исследования
Материалом для настоящей статьи послужили сборы дневных чешуекрылых двух семейств (Pieridae и Satyridae), сделанные с помощью стандартного энтомологического сачка во время маршрутных учетов в течение
полевого сезона 2010 г. Учеты проводили (А.О. Шкурихин, Т.С. Ослина)
в условиях полевого стационара, расположенного в Челябинской области
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
82
А.О. Шкурихин, Т.С. Ослина, Е.Ю. Захарова
(Каслинский р-н., пос. Метлино, 55° 46’ с.ш., 60° 43’ в.д.), с 13 мая по 14 сентября. Поселок Метлино расположен на берегу оз. Кожакуль. Согласно схеме
ботанико-географического районирования Челябинской области Б.П. Колесникова [14], данная территория расположена в лесостепной зоне Зауралья и
Западно-Сибирской равнины, подзоне северной лесостепи.
Ежедневно, за исключением дождливых дней, в первой половине дня и в
полуденные часы бабочек отлавливали на двух маршрутных участках. Первый был расположен на территории самого поселка, второй – на его окраине по опушке березняка и проселочной дороге вдоль поля. Общая длина
маршрутов составила около 5 км. Сведения о сроках лета, числе генераций
и объеме выборок модельных видов приведены в табл. 1.
Таблица 1
Периоды лета имаго модельных видов чешуекрылых в окрестностях пос. Метлино
Челябинской области (2010 г.)
Вид
Aporia crataegi (Linnaeus, 1758)
Pieris napi (Linnaeus, 1758)
Pieris rapae (Linnaeus, 1758)
Pontia edusa (Fabricius, 1777)
Coenonympha glycerion
(Borkhausen, 1788)
Coenonympha pamphilus
(Linnaeus, 1758)
Aphantopus hyperantus
(Linnaeus, 1758)
Генерация
Период лёта
Pieridae
I
2 июня–27 июня
I
13 мая–17 июня
II, III 22 июня–14 сентября
I
13 мая–17 июня
II, III 25 июня–14 сентября
I–II
14 мая–14 сентября
Satyridae
Самцы, Самки,
кол-во кол-во,
экз.
экз.
71
47
156
23
60
522
62
36
90
4
23
370
I
13 июня–23 июля
49
24
I
II
24 мая–21 июня
19 июля–3 сентября
85
58
16
9
I
21 июня–9 июля
108
21
Весь период отлова разделили на десятидневные интервалы. Вычисляли
долю каждого пола в выборке вида за каждую декаду относительно общей
выборки данного вида за весь сезон. Статистическую обработку данных
проводили с помощью пакета программ StatSoft STATISTICA 5.5, используя критерий хи-квадрат для оценки статистической значимости изменений
соотношения полов в течение лёта одной генерации и критерий Стьюдента
для оценки статистической значимости изменений относительного обилия
самцов и самок в течение всего сезона лёта имаго по изменению величины
их долей в выборках за декаду [15].
Результаты исследования и обсуждение
В ходе маршрутных учетов в 2010 г. было выявлено 13 видов сем. Pieridae:
Leptidea morsei (Fenton, 1881), L. reali Reissinger, 1989, L. sinapis (Linnaeus, 1758),
Anthocharis cardamines (Linnaeus, 1758), Euchloe ausonia (Hübner, 1804), Aporia
crataegi, Pieris brassicae (Linnaeus, 1758), P. napi, P. rapae, Pontia edusa, Colias
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Протандрия моно- и поливольтинных видов белянок
83
hyale (Linnaeus, 1758), C. myrmidone (Esper, 1777), Gonepteryx rhamni (Linnaeus,
1758) и 14 видов сем. Satyridae: Pararge aegeria (Linnaeus, 1758), Lasiommata
maera (Linnaeus, 1758), L. petropolitana (Fabricius, 1787), Lopinga achine (Scopoli, 1763), Coenonympha arcania (Linnaeus, 1761), C. glycerion, C. hero (Linnaeus,
1761), C. pamphilus, C. tullia (Müller, 1764), Aphantopus hyperantus, Maniola jurtina
(Linnaeus, 1758), Hyponephele lycaon (Rottemburg, 1775), Erebia aethiops (Esper,
1777), Minois dryas (Scopoli, 1763). Интересной находкой для данной территории
является C. tullia, которая внесена в региональную Красную книгу в качестве
редкого вида, европейская часть ареала которого быстро сокращается (III категория). Ранее, согласно данным Красной Книги… [16], в Челябинской области данный вид был отмечен в трех локалитетах (окр. г. Челябинск, г. Троицк и
пос. Бреды). C. tullia была обнаружена на окраине пос. Метлино Каслинского
р-на 18 июня (3 ♂♂, leg. А.О. Шкурихин) и 29 июня (1 ♂ leg. А.О. Шкурихин).
Для анализа динамики соотношения полов в популяциях были выбраны
7 видов, для которых в наших условиях характерна наибольшая встречаемость. Значения t-критерия Стьюдента, полученные при анализе изменения
относительного обилия имаго этих видов в течение лёта их генераций, приведены в табл. 2 и 3, в которых римскими цифрами обозначены следующие
декады: I – 13–20 мая; II – 21–31 мая; III – 1–10 июня; IV – 11–20 июня;
V – 21–30 июня; VI – 1–10 июля; VII – 11–20 июля; VIII – 21–31 июля; IX –
1–10 августа; X – 11–20 августа; XI – 21–31 августа; XII – 1–14 сентября.
Боярышница (Aporia crataegi) – трансевразиатский температурный лугово-лесной вид с моновольтинным жизненным циклом. Известно, что как
в условиях нашего региона, так и на протяжении всего ареала боярышница
летает в одном поколении за сезон (облигатно-моновольтинный вид). Имаго
A. crataegi отлавливали с 2 по 27 июня 2010 г. в течение всего сезона лёта
генерации. В первую декаду наибольшую долю составили самцы. В последующий период доля самцов в сборах данного вида постепенно сократилась
до нуля, а доля самок соответственно выросла. Все наблюдаемые изменения
относительного обилия у обоих полов боярышницы статистически значимы
(табл. 2). Ко времени окончания лёта (24–27 июня) среди имаго A. crataegi
нами были пойманы только самки (рис. 1, а).
Согласно данным литературы [11], разница в сроках вылета имаго самцов
и самок боярышницы на территории Швеции составляет 2 дня. По нашим наблюдениям, первые самцы этого вида появились 2 июня, а самки – 5 июня, т.е.
мы наблюдаем типичную картину протандрии (χ2 = 32,036; df = 3; p < 0,05).
Белянка брюквенная, брюквенница (Pieris napi), – трансевразиатский
температный лугово-лесной вид с поливольтинным жизненным циклом.
В условиях Южного Урала данный вид может давать от двух до трех генераций за сезон [17]. Имаго P. napi отлавливали в течение всего полевого сезона
с 13 мая по 14 сентября. Начало наших учетов совпало с серединой лёта
первой генерации брюквенницы, поэтому протандрию диапаузирующего
поколения пронаблюдать не удалось.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
А.О. Шкурихин, Т.С. Ослина, Е.Ю. Захарова
84
q
q
Май
Июнь
а
Июль
Август
Сентябрь
q
Май
Июнь
Июль
д
Август
Сентябрь
q
Май
Июнь
Июль
б
q
Август
Сентябрь
Май
Июнь
Июль
е
Август
Сентябрь
q
Май
Июнь
Июль
в
q
Август
Сентябрь
Май
Июнь
Июль
ж
Август
Сентябрь
– среднее обилие самцов в декаду
± ошибка выборочной доли
– среднее обилие самок в декаду
± ошибка выборочной доли
Май
Июнь
Июль
Август
Сентябрь
г
Рис. 1. Сезонная динамика относительного обилия самцов и самок белянок
(а – Aporia crataegi; б – Pieris napi; в – P. rapae; г – Pontia edusa) и бархатниц
(д – Aphantopus hyperantus; е – Coenonympha glycerion; ж – C. pamphilus)
в окрестностях пос. Метлино; q – доля особей в сборах данного вида
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Протандрия моно- и поливольтинных видов белянок
85
Таблица 2
Значения t-критерия Стьюдента при анализе изменения относительного
обилия имаго видов сем. Pieridae в течение лёта их генераций
A. crataegi
P. napi
P. rapae
P. edusa
Самцы Самки Самцы Самки Самцы Самки Самцы Самки
I–II
–
–
0,98
0,92
0,28
0,58
0,58
–
7,93
2,71
3,77
3,35
3,01
II–III
0,28
0,58
0,82
3,03
5,31
2,54
III–IV
0,38
0,45
1,29
–
1,91
2,74
3,41
4,05
6,87
IV–V
1,42
0,45
1,42
1,19
2,91
4,25
3,25
3,71
V–VI
1,52
2,18
0,00
0,91
3,50
3,38
VI–VII
–
–
1,52
1,79
1,42
1,33
3,49
VII–VIII
–
–
0,98
0,84
0,38
1,00
2,02
2,27
7,31
VIII–IX
–
–
0,34
2,00
0,93
1,01
IX–X
–
–
0,16
0,54
1,20
0,00
0,09
0,68
X–XI
–
–
1,25
1,49
0,00
0,38
1,90
0,44
2,09
3,92
XI–XII
–
–
1,36
0,26
0,22
1,19
Примечание. Полужирным шрифтом указаны статистически значимые различия (р<0,05).
Декады
Сезонная динамика относительного обилия самцов и самок P. napi в течение
всего летнего сезона проиллюстрирована на рис. 1, б. Как видно из графика,
в конце мая относительное обилие брюквенниц статистически значимо снизилось и достигло минимума в течение первых двух декад июня (табл. 2). Таким
образом, к середине июня заканчивается лёт имаго первого поколения. Вылет
самок второй генерации происходит позднее, чем вылет самцов, но существование протандрии не подтверждается критерием хи-квадрат (χ2 = 0,994; df = 3;
p = 0,86). Сроки лёта второй и третьей генераций в значительной степени перекрываются, поэтому резкого снижения относительной численности бабочек
при смене этих поколений не наблюдается. В целом обилие брюквенниц второй
и третьей генераций изменялось статистически не значимо, но мы наблюдали
снижение их обилия к середине сентября.
Таблица 3
Значения t-критерия Стьюдента при анализе изменения относительного
обилия имаго видов сем. Satyridae в течение лёта их генераций
A. hyperanthus
C. glycerion
C. pamphilus
Самцы
Самки
Самцы
Самки
Самцы
Самки
7,36
I–II
–
–
–
–
1,42
II–III
–
–
–
–
0,78
1,69
4,32
4,53
III–IV
–
–
2,30
0,26
13,96
3,62
3,09
IV–V
2,03
2,38
2,38
7,00
6,68
3,07
V–VI
0,61
–
1,00
5,92
4,09
2,70
VI–VII
–
–
–
VII–VIII
–
–
–
–
0,28
–
VIII–IX
–
–
–
1,42
0,79
1,00
3,91
IX–X
–
–
–
–
1,00
5,39
X–XI
–
–
–
–
1,00
XI–XII
–
–
–
–
1,00
–
Примечание. Полужирным шрифтом указаны статистически значимые различия (р<0,05).
Декады
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
86
А.О. Шкурихин, Т.С. Ослина, Е.Ю. Захарова
Белянка репная, репница (Pieris rapae), – транспалеарктический температный лугово-степной вид с поливольтинным жизненным циклом, приуроченный к культурным ландшафтам. В условиях Южного Урала летает в
двух-трех генерациях за сезон [17].
Сезонная динамика относительного обилия репницы проиллюстрирована на рис. 1, в. Первых самцов мы отловили 14 мая, а первых самок –
16 мая, что можно охарактеризовать как протандрию у диапаузирующего
поколения репницы. Однако статистическая проверка характера сезонной
динамики относительного обилия самцов и самок показала отсутствие статистически значимых различий. В первой половине лета существует общая
тенденция снижения относительного обилия репницы, а во второй половине
лета, напротив, обилие возрастает. Мы наблюдаем лёт имаго трех генераций
P. rapae, которые перекрываются во времени. В целом относительное обилие самцов статистически значимо превышает относительное обилие самок
(всего отловлено 83 самца и 27 самок), но вследствие небольших объемов
выборок изменения обилия репницы в течение сезона лёта незначимы (см.
табл. 2). По нашим наблюдениям, из двух видов рода Pieris, обитающих совместно в одних биотопах, репница малочисленнее и сезонная динамика их
лёта находится в «противофазе»: P. napi достигает максимальной численности в конце весны и середине лета, в то время как P. rapae наиболее многочисленна к концу лета – началу осени.
Белянка рапсовая (Pontia edusa) – трансевразиатский температно-южносибирский вид с поливольтинным жизненным циклом, приуроченный к рудеральным участкам. В условиях Южного Урала данный вид имеет два или
три поколения за сезон в зависимости от погодных условий. По наблюдениям
П.Ю. Горбунова и О.Э. Костерина [18], в степной зоне более многочисленны
второе и последующие поколения, а в южной тайге и Зауралье первая генерация может практически полностью отсутствовать. В июне появляются непосредственно имаго второй генерации за счет мигрантов из более южных районов. Потомки этих мигрантов формируют более многочисленное поколение,
вылетающее в августе – начале сентября. Неоднократны массовые появления
имаго данного вида: например, Ю.П. Коршунов [19] описывал, как в сентябре 1961 г. наблюдал на юге Телецкого озера множество P. edusa на цветках
тысячелистника. В 2010 г. мы отлавливали рапсовую белянку в окрестностях
с. Нижнеиргинское (Красноуфимский р-н Свердловской обл.), расположенного в азональной лесостепи подзоны южной тайги (leg. Е.Ю. Захарова, П.В. Рудоискатель). За пару часов нами было отловлено 132 экз. P. edusa, которые
кормились на икотнике и тысячелистнике. По-видимому, высокие показатели
обилия этого вида на Среднем и Южном Урале в конце лета 2010 г. можно
объяснить жаркими сухими погодными условиями этого сезона.
В окрестностях пос. Метлино P. edusa отлавливали в течение всего полевого сезона с 14 мая по 14 сентября (см. рис. 1, г). В мае обилие имаго P. edusa невелико; были отловлены исключительно самцы (14 мая 1♂;
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Протандрия моно- и поливольтинных видов белянок
87
24 мая 1♂; 25 мая 1♂). Первая самка встречена только 2 июня, что указывает
на существование протандрии у данного вида (χ2 = 58,976; df = 10; p < 0,05).
Статистически значимое обилие бабочек данного вида возросло к середине
июня, к концу июня относительное обилие самцов достигло первого пика
(см. табл. 2). Вследствие небольшого объема выборок изменения относительного обилия самок статистически не значимы до начала августа. В первой декаде августа относительное обилие как самцов, так и самок резко возросло, достигло пика и снизилось только в начале сентября. Таким образом,
к концу лета – началу осени рапсовая белянка становится наиболее массовым видом дневных чешуекрылых из двух изучаемых семейств.
Глазок цветочный (Aphantopus hyperantus) – трансевразиатский температный лугово-лесной вид с моновольтинным жизненным циклом. Имаго
A. hyperantus отлавливали с 21 июня по 9 июля (рис. 1, д). Первые самцы были
отловлены 21 июня, а самки – 26 июня. Таким образом, вылет имаго самцов
начался на 5 дней раньше вылета имаго самок. Протандрию в природных популяциях A. hyperantus мы наблюдали ранее в Ильменском заповеднике [20] и
ряде других местообитаний вида на Среднем и Южном Урале.
В третьей декаде июня относительное обилие как самцов, так и самок
A. hyperantus статистически значимо возросло, при этом доля отловленных
самцов превышала долю самок в 8 раз (см. табл. 3). В последующий период
относительное обилие самцов резко снизилось, а самок – не изменилось.
Последние пойманные нами бабочки вида A. hyperantus были самками, что
указывает на существование протандрии у данного вида (χ2 = 8,736; df = 2;
p < 0,05).
Сенница луговая (Coenonympha glycerion) – трансевразиатский температный вид с моновольтинным жизненным циклом. Лёт имаго С. glycerion длился с 13 июня по 23 июля (рис. 1, е). Первые самцы были пойманы
13 июня, а первые самки – только через 2 дня (15 июня). Обилие бабочек
статистически значимо увеличивалось со второй до третьей декады июня,
а затем снизилось к началу июля (см. табл. 3). В июне наибольшую долю
в сборах составили самцы, к первой декаде июля соотношение полов стало равным. Все пойманные нами в последующий период особи С. glycerion
были самками. Несмотря на то что существует явная тенденция к более раннему вылету имаго самцов у данного вида, статистически существование
протандрии не подтверждено (χ2 = 0,774; df = 2; p = 0,68).
Сенница памфил (Coenonympha pamphilus) – широко распространенный трансевразиатский вид. В Крыму и на Кавказе он развивается в
2–3 поколениях и лёт бабочек происходит в течение всего теплого времени
года, с мая по октябрь [21, 22]. Для Сибири Ю.П. Коршунов [19] указывает
лёт на юге лесной зоны в июне в одном поколении, а южнее, в лесостепи
и степи, в мае – июне и в конце июля – августе в двух поколениях. Согласно данным литературы [17] и нашим наблюдениям, на Южном Урале вид
также развивается в двух поколениях. На Среднем Урале наблюдать лёт
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
88
А.О. Шкурихин, Т.С. Ослина, Е.Ю. Захарова
двух генераций удается не ежегодно; в наиболее северных частях ареала
вид становится моновольтинным, и лишь изредка в благоприятные теплые
летние сезоны появляется малочисленное второе поколение. Например, в
2010 г., для которого было характерно жаркое лето, мы наблюдали вылет
второй генерации C. pamphilus в Красноуфимском (leg. Е.Ю. Захарова),
Сысертском и Ирбитском (leg. П.В. Рудоискатель) районах Свердловской
области (56–57º с.ш.).
В окрестностях пос. Метлино мы отлавливали первую генерацию
C. pamphilus с 24 мая по 21 июня и вторую генерацию – с 19 июля по 3 сентября (рис. 1, ж). Изменения относительного обилия самок недостоверны на
протяжении всего сезона из-за небольшого объема их выборок (всего было
поймано 16 самок I генерации и 9 самок II генерации). Относительное обилие
самцов статистически значимо возрастает в конце мая и достигает первого
пика, а затем снижается к середине июня (см. табл. 3). В последнюю декаду
июня пойман только 1 самец. В первой декаде августа относительное обилие
самцов С. pamphilus вновь статистически значимо увеличивается и достигает
второго пика к середине августа, а затем в течение третьей декады резко снижается. Более ранний вылет самцов по сравнению с самками статистически
достоверен (χ2 = 15,99; df = 2; p < 0,01). Таким образом, для C. pamphilus характерен лёт двух неперекрывающихся во времени поколений имаго, причем
численно преобладают самцы, вылет которых начинается раньше.
Заключение
Проведенные нами учеты относительного обилия видов дневных чешуекрылых, относящихся к семействам Pieridae и Satyridae и обитающих совместно в лесостепной зоне Южного Урала, позволили отнести изученные
виды к различным фенологическим группам. Названия фенологических периодов мы приводим по работе Л.Е. Сасовой и А.Б. Мартыненко [23]. Наиболее массовыми в поздневесеннем периоде являлись огородные белянки
Pieris napi и P. rapae, в раннелетнем – Coenonympha pamphilus, в первом
среднелетнем периоде моновольтинные виды Aporia crataegi, Aphantopus
hyperantus, Coenonympha glycerion численно доминируют в сообществе. Во
втором среднелетнем и позднелетнем периодах показатели относительного
обилия P. napi снижаются, а соответствующие показатели P. rapae и P. edusa
увеличиваются. К середине сентября безусловно доминирует P. edusa, которая становится весьма многочисленной. Анализ сезонной динамики соотношения полов позволяет предположить наличие протандрии для всех семи
изученных видов. Однако если для видов с моновольтинным жизненным
циклом (A. crataegi, A. hyperantus, C. glycerion) протандрию легко наблюдать в природных условиях и она была статистически достоверна (за исключением C. glycerion), то для би- и поливольтинных видов картина не столь
однозначна. У бивольтинной сенницы C. pamphilus, лёт генераций которой
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Протандрия моно- и поливольтинных видов белянок
89
не перекрывается во времени, достоверно обнаружен более ранний вылет
имаго самцов как в первом, так и во втором поколениях. У видов, лёт генераций которых происходит в природных условиях одновременно, оказывается
сложным их разделить, поэтому протандрию зарегистрировать не удается.
Тем не менее как данные литературы [11], так и наши наблюдения свидетельствуют, что для поливольтинных видов белянок и бархатниц характерна
тенденция более раннего вылета имаго самцов по крайней мере для первого,
диапаузирующего поколения.
Авторы выражают искреннюю признательность д-ру биол. наук, проф.
А.Г. Васильеву за ценные замечания и обсуждение результатов, полученных
в ходе работы, и канд. биол. наук М.В. Чибиряку за организацию полевых
работ (лаборатория эволюционной экологии Института экологии растений и животных УрО РАН, г. Екатеринбург), а также П.В. Рудоискателю
(Уральский федеральный университет им. первого президента Б.Н. Ельцина, г. Екатеринбург) – за помощь в экспедиционных полевых работах на
территории Свердловской области в 2010 г.
Литература
1. Butterflies: Ecology and Evolution Taking Flight / eds. by C.L. Boggs, Watt W.B., Ehrlich P.R. University of Chicago Press, Chicago and London. 2003. 756 p.
2. Дубатолов В.В., Костерин О.Э. Дневные чешуекрылые (Lepidoptera, Hesperioidea,
Papilionoidea) международного заповедника «Даурия» // Насекомые Даурии и сопредельных территорий. Новосибирск: SWEF, 1999. Вып. 2. С. 138–194.
3. Мартыненко А.Б. Фенология и сезонная динамика лёта дневных чешуекрылых (Lepidoptera, Diurna) на юге Дальнего Востока и в Забайкалье // Чтения памяти Алексея
Ивановича Куренцова. 2003. Вып. XIII. С. 69–85.
4. Татаринов А.Г., Долгин М.М. Видовое разнообразие булавоусых чешуекрылых на европейском Северо-Востоке России. СПб. : Наука, 2001. 244 с.
5. Olschwang V.N. Rhopalocera from the south Urals: biodiversity and population dynamics //
Mem. Soc. r. belge Ent. 1998. Vol. 38. P. 145–154.
6. Нужнова О.К. Сезонная динамика активности брюквенницы (Pieris napi L.) на территории Мурманской и Калужской областей // Труды Ставропольского отделения РЭО
: материалы II Междунар. науч.-практ. конф. «Актуальные вопросы энтомологии».
Ставрополь : АГРУС, 2009. С. 122–125.
7. Горбач В.В., Резниченко Е.С., Сааринен К. К экологии тополевого ленточника (Limenitis
populi, Lepidoptera, Nymphalidae) Восточной Фенноскандии // Зоологический журнал. 2010. Т. 89, № 11. C. 1340–1349.
8. Захарова Е.Ю. Сезонная изменчивость длины крыла и глазчатых пятен в популяциях
Erebia ligea L. (Lepidoptera, Satyridae) на Среднем Урале // Энтомологическое обозрение. 2010. Т. 89, № 2. С. 320–332.
9. Morbey Y., Ydenberg R. Protandrous arrival timing to breeding areas: a review // Ecology
Letters. 2001. Vol. 4. P. 663–673.
10. Wiklund C., Nylin S., Forsberg J. Sex-related variation in growth rate as a result of selection for large size and protandry in a bivoltine butterfly, Pieris napi // Oikos. 1991. Vol. 60.
P. 241–250.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
90
А.О. Шкурихин, Т.С. Ослина, Е.Ю. Захарова
11. Wiklund C., Forsberg J. Sexual size dimorphism in relation to female polygamy and protandry in butterflies: a comparative study of Swedish Pieridae and Satyridae // Oikos. 1991.
Vol. 60. P. 373–381.
12. Zonneveld C. Being big or emerging early? Polyandry and the trade-off between size and
emergence in male butterflies // The American Naturalist. 1996. Vol. 147, № 6. Р. 946–965.
13. Wiklund C., Fagerström T. Why do males emerge before females? A Hypothesis to explain
the incidence of protandry in butterflies // Oecologia. 1977. Vol. 31. P. 153–158.
14. Колесников Б.П. Очерк растительности Челябинской области в связи с ее геоботаническим районированием // Флора и растительность Ильменского государственного
заповедника им. В.И. Ленина. Свердловск : УФАН СССР, 1961. Вып. 8. С. 105–129.
15. Песенко Ю.А. Принципы и методы количественного анализа в фаунистических исследованиях. М. : Наука, 1982. 286 с.
16. Красная Книга Челябинской области: животные, растения, грибы / отв. ред. Н.С. Корытин. Екатеринбург : Изд-во Урал. ун-та, 2005. 450 с.
17. Ольшванг В.Н., Нуппонен К.Т., Лагунов А.В., Горбунов П.Ю. Чешуекрылые Ильменского заповедника. Екатеринбург : ИГЗ УрО РАН, 2004. 288 с.
18. Gorbunov P., Kosterin O. The butterflies (Hesperioidea and Papilionoidea) of North Asia
(Asian part of Russia) in nature. Moscow : Rodina & Fodio, 2003. Vol. I. 392 p.
19. Коршунов Ю.П. Булавоусые чешуекрылые Северной Азии. М. : КМК, 2002. 424 с.
20. Захарова Е.Ю. Протандрия и изменчивость размеров в популяциях моновольтинных
видов бархатниц (Lepidoptera: Satyridae) // Евразиатский энтомологический журнал.
2004. Т. 3, вып. 1. С. 59–65.
21. Некрутенко Ю.П. Булавоусые чешуекрылые Крыма. Киев : Наукова думка, 1985. 152 с.
22. Некрутенко Ю.П. Дневные бабочки Кавказа. Киев : Наукова думка, 1990. 216 с.
23. Сасова Л.Е., Мартыненко А.Б. Сезонные аспекты населения дневных чешуекрылых
(Lepidoptera, Diurna) в широколиственных лесах Уссурийского заповедника // Вестник Оренбургского государственного университета. 2007. № 10. С. 156–161.
Поступила в редакцию 13.09.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 80–91
Aleksey O. Shkurikhin, Tatyana S. Oslina, ElenaYu. Zakharova
Institute of Plant and Animal Ecology of Ural Division of
Russian Academy of Sciences, Ekaterinburg, Russia
PROTANDRY IN MONO- AND POLYVOLTINE WHITES AND SATYRS
SPECIES (Lepidoptera, Pieridae, Satyridae) FROM THE SOUTH URALS
FOREST-STEPPE ZONE
Protandry (the earlier adult emergence of males than females) is a common pattern
of sex-biased timing in many animal taxa. In case of Rhopalocerous species it is usually related with reproductive strategy, sexual size dimorphism and life history traits.
Protandry can be easily observed in monovoltine butterflies species both in natural
conditions and in laboratory experiments. In some bivoltine species it is observed in
generations with direct development as well as in diapausing generations. But when
the emergence periods of several generations are overlapped in natural conditions it is
difficult to observe protandry. In species with a high degree of females monogamy and
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Протандрия моно- и поливольтинных видов белянок
91
males polygamy in the reproductive strategy the amount of protandry increases. And it
is expected to decline with the degree of polyandry obviously. In the present paper we
study seasonal abundance of whites and satyrs species (Lepidoptera, Pieridae, Satyridae) from the South Urals forest-steppe zone. The most abundant species during the
late spring period were Pieris napi and P. rapae. Then during the early summer the
most abundant species becomes Coenonympha pamphilus. Monovoltine species Aporia
crataegi, Aphantopus hyperantu and Coenonympha glycerion prevail during the first
middle summer period. During the second middle summer and late summer periods
Pontia edusa dominates and again relative abundance of P. rapae is increased. We
analyse seasonal sex ratio dynamics of abundant species during the flight period of
all their generations from May to September of 2010 year. Protandry was significantly
found for monovoltine species (Aporia crataegi, Aphantopus hyperantus, Coenonympha glycerion) and bivoltine species with two discrete generations (Сoenonympha
pamphilus). There is a tendency of the earlier emergence of male imago than female for
the first diapausing generation of polyvoltine Pieridae with overlapping generations
(Pieris napi, P. rapae и Pontia edusa) but protandry is not significant.
Key words: protandry; dynamics of sex ratio; generation; Pieridae; Satyridae.
Received September 13, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 92–95
ФИЗИОЛОГИЯ И БИОХИМИЯ РАСТЕНИЙ
УДК 581.1
Х.Х. Алобайди1, Е.Б. Башмакова2, В.П. Холодова2
Российский университет дружбы народов (г. Москва)
Институт физиологии растений им. К.А. Тимирязева РАН (г. Москва)
1
2
СРАВНИТЕЛЬНЫЙ АНАЛИЗ УСТОЙЧИВОСТИ РАСТЕНИЙ
РОДА Brassica НА НАЧАЛЬНОМ ЭТАПЕ ОНТОГЕНЕЗА
К ИЗБЫТКУ МЕДИ
Материалы опубликованы в рамках проекта ФЦП «Организационно-техническое
обеспечение проведения международной научной школы «Перспективные направления
физико-химической биологии и биотехнологии»
(ГК № 14.741.12.0153 от 07 июня 2011 г.).
Исследована устойчивость растений 3 видов рода Brassica (В. juncea L.,
В. niger и B. alba) к избыточной концентрации ионов меди в среде. Отсутствие
токсичного влияния различных концентраций меди (10, 25, 50, 100, 200 и 300 µM)
оценивалось по прорастанию семян и росту корня проростков. Установлена высокая устойчивость проростков B. alba к токсичным концентрациям сульфата
меди, что делает этот вид перспективным для фиторемедиации.
Ключевые слова: растения р. Brassica; B. alba; В. juncea; B. niger; фиторемедиация; медь.
Введение
Медь – эссенциальный элемент, являющийся кофактором таких ферментов, как супероксиддисмутаза и лакказа, и входящий в состав важнейших
функциональных белков, например пластоцианина. Вместе с тем в избыточных концентрациях в среде ионы меди оказывают негативное действие на
растения [1–3], занимая одно из первых мест по токсичности среди тяжелых
металлов. Основными источниками загрязнения почв медью являются, с одной стороны, горнодобывающая и перерабатывающая промышленность, а с
другой – агропромышленное производство, использующее препараты меди
для борьбы с болезнями и вредителями. В связи с этим остро стоит задача
очистки почв сельскохозяйственного назначения и городских территорий от
избытка меди [4]. Известно, что эффективными для фиторемедиации являются растения, обладающие выраженной устойчивостью к меди и хорошо
развитой надземной биомассой. К такого рода растениям относятся представители рода Brassica. Таким образом, целью работы являлась оценка устойчивости трех видов горчицы, потенциально перспективных для фиторемедиации с избыточным содержанием меди в почве.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Сравнительный анализ устойчивости растений
93
Материалы и методики исследования
Работа выполнена на растениях 3 видов рода Brassica, из которых
В. juncea L. культивируется в России преимущественно в условиях аридных
зон, семена В. niger и B. alba дикого типа получены из Багдадского региона
Ирака. Для определения влияния меди на прорастание семена дезинфицировали слаборозовым раствором перманганата калия и после промывки дистиллированной водой помещали на фильтровальную бумагу в стерильные
чашки Петри, содержавшие в контроле дистиллированную воду, в опытных
вариантах – сульфат меди (CuSO4) в концентрациях 10, 25, 50, 100, 200 и
300 µM. Семена проращивали при 20–22ºC; через трое суток с момента постановки эксперимента подсчитывали число проросших семян и измеряли
длину корня проростка. Статистическая обработка данных проведена с помощью пакета прикладных программ StatSoft STATISTICA 6.0. Результаты
экспериментов представлены в виде средних арифметических со стандартными ошибками. Статистическая значимость различий р < 0,05.
Результаты исследования и обсуждение
Установлено, что повышенные концентрации меди негативно влияли на
прорастание семян всех исследованных видов Brassica, полная потеря всхожести семян происходила при 300 µM CuSO4. Различия в реакции видов на
присутствие меди в среде проявлялись уже при 10 µM: прорастание B. niger и
B. juncea заметно подавлялись, но растения вида B. alba по всхожести и длине корня практически не отличались от проростков в контрольном варианте.
Однако отсутствие значительной разницы по всхожести семян для разных видов от контрольного варианта не позволяло подробно изучить механизм влияния избытка меди на рост и развитие проростков растений рода Brassica. Для
уточнения полученных значений и более подробной оценки был проведен
пересчет действия меди по отношению к прорастанию в контрольном варианте каждого из видов (рис. 1). Высокую устойчивость B. alba можно отметить
не только при 10 µM, но и при 100 и 200 µM CuSO4. B. niger при умеренных
концентрациях меди (25 и 50 µM) не уступал по устойчивости B. alba, но присутствие меди в среде в количестве 100–200 µM значительно сильнее снижало
прорастание B. niger по сравнению с двумя другими видами.
Таким образом, повышенные концентрации сульфата меди в среде заметно
снижали длину корней проростков всех трех видов. При этом, учитывая значительно более быстрый рост корней проростков B. juncea и B. niger по отношению к B. alba, для улучшения восприятия при сравнении экспериментальные данные представлены в виде относительных величин в % от контрольных
показателей для каждого из видов (рис. 2). Представленные в таком виде показатели роста и развития растений отчетливо иллюстрируют, что растения
вида B. alba на ранних этапах своего развития менее всего восприимчивы к
избыточным концентрациям меди в среде: значимое снижение их роста от-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Х.Х. Алобайди, Е.Б. Башмакова, В.П. Холодова
94
мечено только с 50 мкМ CuSO4, и даже при максимальной из использованных
концентраций рост корня снизился до 40% от контроля, тогда как у растений
видов B. juncea и B. niger – не превышал 15–20% от контроля.
120
1 2 3
100
%
80
60
40
20
0
0
10
25
50
CuSO4 µМ
100
200
Рис. 1. Действие CuSO4 на прорастание семян (% проросших семян
от контроля для каждого варианта): 1 – B. alba; 2 – B. juncea; 3 – B. niger
120
1 2 3
100
%
80
60
40
20
0
0
10
25
50
CuSO4 µМ
100
200
Рис. 2. Действие CuSO4 на рост корня проростка.
Обозначения см. на рис. 1
Заключение
Таким образом, представленные результаты позволяют заключить, что
на начальном этапе онтогенеза проростки B. alba, в отличие от проростков
B. juncea и B. niger, показали высокую устойчивость к токсичным концентрациям CuSO4, что делает этот вид перспективным для использования в
целях фиторемедиации.
Литература
1. Иванова Е.М., Холодова В.П., Кузнецов Вл.В. Биологические эффекты высоких концентраций солей меди и цинка и характер их взаимодействия в растениях рапса //
Физиология растений. 2010. № 6. С. 864–873.
2. Kholodova V., Volkov K., Kuznetsov Vl. Plants under Heavy Metal Stress in Saline Environments // Soil Heavy Metals. Series «Soil Biology». 19, Heidelberg, Dordrecht. London ;
New York : Springer-Verlag, 2010. P. 163–183.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Сравнительный анализ устойчивости растений
95
3. Куликова А.Л., Холодова В.П., Кузнецов В.В. Актин вовлекается в ранние ответные реакции растений на действие тяжелых металлов и ассоциирует с молекулярными шаперонами в условиях стресса // Доклады АН. 2009. Т. 424. С. 426–429.
4. Xiong Z-T., and Wang H. Copper toxicity and bioaccumulation in Chinese cabbage (Brassica pekinensis Rupr.) // Wiley Periodicals, Inc. Environ Toxicol. 2005. № 20. С. 188–194.
Поступила в редакцию 17.06.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 92–95
Khalid Hashem Alobadi1, Elena B. Bashmakova1, Valentina P. Kholodova2
Peoples’ Friendship University of Russia, Moscow, Russia
Timiryazev Institute of Plant Physiology, Russian Academy of Science, Moscow, Russia
1
2
A COMPARATIVE ANALYSIS OF RESISTANCE OF THREE
SPECIES OF THE GENUS Brassica TO EXCESS COPPER
CONCENTRATION AT THE INITIAL STAGE OF ONTOGENESIS
The main sources of soil contamination with copper are on one hand, mining and
processing industry, and on the other hand, the agro-industry, using copper drugs to
combat diseases and pests. In connection with this problem is acute treatment of soil for
agricultural purposes and urban areas of excess copper.
The purpose of this study was to search for plants that have expressed resistance to
copper and a well-developed aerial biomass. This species of plants are members of the
genus Brassica. This study assessing the sustainability of an excess of Cu in 3 kinds of
mustard which are potentially promising for phytoremediation.Work was performed on
3 species of plants genus, Brassica B. juncea, B. niger, and B. alba. We have studied the
germination of seeds depending on the concentration of copper (10, 25, 50, 100, 200
and 300 μM). Seeds were germinated at 20–22 º C; for 3 days, counted the number of
germinated seeds and measured the length of seedling roots. Elevated concentrations of
copper negatively affected the germination of all Brassica species studied, a complete
loss of germination occurred at 300 μM CuSO4. Differences between species became
obviously already at 10 μM while B. alba did not differ from controls, but germination
of B. niger, and B. juncea significantly suppressed. However, a strong difference in seed
germination of different species in the control variants, without the influence of copper,
not strictly allowed comparing the effect on them of excess copper. For this conversion
was carried out of the copper in relation to germination in the control of each species.
High stability of the B. alba can be noted not only at 10 μM, but at 100 and 200 μM
CuSO4. B. niger at moderate concentrations of copper (25 and 50 μM) did not shows the
stability of B. alba, but the 100–200 μM CuSO4 significantly more reduced germination
of B. niger in comparison with the other two species.Elevated concentrations of CuSO4
significantly decreased the length of seedling roots of all three species. In this case,
given the much more rapid growth of seedling roots B. juncea and B. niger in relation
to B. alba, to compare the relative values ​​are presented as % of control for each species.
Thus, the presented results suggest that early in ontogeny seedlings of B. alba, in
contrast to B. juncea and B. niger, showed high resistance to toxic concentrations of
CuSO4, which makes this species a promise for use in phytoremediation.
Key words: B. alba; В. juncea; B. niger; phytoremediation; copper.
Received June 17, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 96–99
УДК 581.1
М.М. Мараей1, Г.Н. Ралдугина2, В.П. Холодова2
1
Российский университет дружбы народов (г. Москва)
Институт физиологии растений им. К.А. Тимирязева РАН (г. Москва)
2
СРАВНИТЕЛЬНЫЙ АНАЛИЗ УСТОЙЧИВОСТИ ДВУХ СОРТОВ
ЯРОВОГО РАПСА (Brassica napus L.) К ДЕЙСТВИЮ
ВЫСОКИХ КОНЦЕНТРАЦИЙ ЦИНКА
Материалы опубликованы в рамках проекта ФЦП «Организационно-техническое
обеспечение проведения международной научной школы «Перспективные
направления физико-химической биологии и биотехнологии»»
(ГК № 14.741.12.0153 от 07 июня 2011 г.).
Оценена способность растений двух сортов рапса (Вестар и Подмосковный) накапливать ионы цинка и аккумулировать надземную биомассу на фоне действия
различных концентраций (100, 250 и 500 мкМ) солей цинка. Установлено, что растения исследованных сортов рапса обладают выраженной способностью к аккумуляции цинка в надземных органах без значительного снижения накопления биомассы
и изменения уровня свободного пролина в растениях. Обнаружены высокая устойчивость растений рапса данных сортов к избыточному содержанию ионов цинка в
среде и проявление их фиторемедиационного потенциала.
Ключевые слова: Brassica napus; цинк; пролин; фиторемедиация.
Введение
Растения, перспективные для использования в целях фиторемедиации,
должны обладать высокой устойчивостью к тяжелым металлам, способностью к их гипераккумуляции и развитию большой надземной биомассы в
стрессорных условиях [1, 2]. В этой связи большой интерес представляют
растения рода Brassica.
Цель работы заключалась в том, чтобы оценить способность растений
двух сортов рапса (Вестар и Подмосковный) накапливать ионы цинка и аккумулировать надземную биомассу на фоне действия различных концентраций соли цинка.
Материалы и методики исследования
Семена растений по 50–70 шт. высевали на поверхность влажного перлита в пластмассовые кюветы (40×30×8 см) с отверстиями на дне, после чего
растения выращивали в водной культуре в камере фитотрона в контролируемых условиях. Содержание свободного пролина в растениях определяли с
помощью кислого нингидринового реактива [3]. Определение содержания
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Сравнительный анализ устойчивости двух сортов
97
цинка в тканях растений проводили по методу Голубкиной [4]. При определении оводненности, содержания пролина и металлов использовали среднюю выборку всех листьев варианта, не считая семядольных. Все опыты
проводили в трехкратной биологической повторности. Статистическая обработка данных проведена с помощью программы Excel. Результаты представлены в виде средних арифметических и ошибки репрезентативности
среднего квадратического отклонения.
Результаты исследования и обсуждение
Содержание ионов цинка в листьях рапса в контрольных растениях составляло 60,7 мкг цинка/г сухой массы листьев сорта Вестар и 53,85 мкг
цинка/г сорта Подмосковный (табл. 1). При внесении в среду солей цинка в
концентрации 100 мкМ через 7 дней экспозиции количество металла в листьях превышало контроль в 1,9 и 4 раза, а через 15 дней – в 2,1 и 2,8 раза
соответственно. Присутствие в среде 250 мкМ ZnSO4 приводило к превышению контрольных показателей содержания Zn в 2,6 и 6,3 раза через 7 дней
и в 2,5 и 5,5 раза через 15 дней. После 7 дней действия 500 мкМ ZnSO4 содержание ионов цинка в растениях превышало контроль в 3,5 и 11,5 раза, а
после 15 дней – более чем в 5 раз у обоих сортов.
Таблица 1
Содержание ионов цинка в листьях рапса, мкг/г сухой массы
Вариант
Контроль
100 мкМ ZnSO4
250 мкМ ZnSO4
500 мкМ ZnSO4
Вестар
(7 дней)
33,2
58,2
86,7
187,9
Подмосковный
(7 дней)
18,16
83,97
111,1
209,53
Вестар
(15 дней)
60,7
131,5
158,5
350,35
Подмосковный
(15 дней)
53,85
151,59
291,78
319,6
Значительная аккумуляция ионов цинка в листьях рапса практически
не влияла на уровень свободного пролина в тканях. Как видно из данных
табл. 2, 7–15-дневное воздействие растворов ZnSO4 на растения в концентрациях 100, 250 и 500 мкМ обнаруживало лишь слабое увеличение содержания свободного пролина в листьях (табл. 2).
Таблица 2
Влияние сульфата цинка на аккумуляцию пролина в растениях
рапса, мкмоль/г сухой массы
Вариант
Контроль
100 мкМ ZnSO4
250 мкМ ZnSO4
500 мкМ ZnSO4
Вестар
(7 дней)
8,2±08
12,2±1,2
14,3±1,4
12,1±1,2
Подмосковный
(7 дней)
7,3±0,6
11,8±1,2
13,4±1,4
11,5±1,1
Вестар
(15 дней)
12,1±1,2
13,4±1,3
16,5±1,4
14,3±1,5
Подмосковный
(15 дней)
11,2±1,2
12,3±1,3
14,5±1,5
13,6±1,2
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
М.М. Мараей, Г.Н. Ралдугина, В.П. Холодова
98
При этом оба сравниваемых сорта рапса практически не отличались способностью аккумулировать пролин в ответ на действие избыточных концентраций солей цинка в среде.
Несмотря на то что растения рапса накапливали достаточно много ионов
цинка при его избыточном содержании в среде, ингибирующий эффект солей цинка на накопление биомассы был выражен незначительно. При максимальной концентрации сульфата цинка (500 мкМ) в среде торможение аккумуляции биомассы растений не превышало 20%, что говорит о довольно
высокой устойчивости исследуемых сортов растений рапса.
Заключение
Таким образом, растения рапса сортов Вестар и Подмосковный обладают выраженной способностью к аккумуляции ионов цинка в надземных
органах без значительного снижения аккумуляции биомассы. Эти данные
свидетельствуют о довольно высокой устойчивости растений рапса данных
сортов к избыточному содержанию солей цинка в среде и об их достаточно
высоком фиторемедиационном потенциале.
Литература
1. Kholodova V., Volkov K., Kuznetsov Vl. Plants under Heavy Metal Stress in Saline
Environments // Soil Heavy Metals. Ser. Soil Biology. 19, Heidelberg, Dordrecht. London ;
New York : Springer-Verlag, 2010. Р. 163–183.
2. Иванова Е.М., Холодова В.П., Кузнецов Вл.В. Биологические эффекты высоких концентраций солей меди и цинка и характер их взаимодействия в растениях рапса //
Физиология растений. 2010. № 6. С. 864–873.
3. Bates L.S., Waldren R.P., Teare I.D. Rapid determination of free proline for water-stress studies // Plant and Soil. 1973. Vol. 39. P. 205–207.
4. Голубкина Н.А. Флуорометрический метод определения селена // Журнал аналитической химии. 1995. Т. 50. С. 492–497.
Поступила в редакцию 15.06.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 96–99
Mohammed М. Маree1, Galina N. Raldugina2, Valentina P. Kholodova2
Peoples’ Friendship University of Russia, Moscow, Russia
Timiryazev Institute of Plant Physiology of Russian Academy of Science, Moscow, Russia
1
2
COMPARATIVE ANALYSIS OF THE STABILITY OF TWO TYPES
OF SPRING RAPE (Brassica napus) TO THE ACTION OF THE IONS ZINC
This study was to assess the ability of plants of two varieties of canola (Westar and
Moscow Region), the zinc ions accumulate aboveground biomass on the background of
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Сравнительный анализ устойчивости двух сортов
99
various concentrations of zinc salts (ZnSO4). Seeds were sown on the surface of moist
perlite in a plastic cuvette (40×30×8 см) with holes at the bottom of 50–70 pieces,
after which the plants were grown in water culture in a phytotron chamber under controlled
conditions. The content of free proline levels of zinc in leaves of plants and biomass plants.
The zinc content in the leaves of canola in the control plants was 60,7 and 53,85 mcg
of zinc/g dry leaf varieties Westar and Moscow region. In making the medium zinc concentrations of 100 uM after 7 days exposure of the metal in the leaves exceeded the
control by 1,9 and 4 times, and after 15 days – 2,1 and 2,8 times, respectively.
The presence of the 250 uM ZnSO4 resulted in exceeding targets Zn content of 2,6
and 6,3 times after 7 days and 2,5 and 5,5 times in 15 days. After 7 days of 500 uM
ZnSO4, zinc in the plants exceeded the control by 3,5 and 11,5 times, and after 15 days –
more than 5 times in both varieties. A significant accumulation of zinc ions in the leaves
of rape is almost no effect on the level of free proline in tissues. In this case both of
the compared varieties of rape is not much different ability to accumulate proline in
response to excess concentrations of zinc in the environment. Despite the fact that rape
plants accumulated a lot of zinc in excess of its content in the medium, the inhibiting
effect of zinc on the accumulation of biomass was rather weakly expressed.
Thus, plants of both varieties of rape have compared pronounced ability to accumulate zinc in the aboveground organs without significantly reducing the accumulation
of biomass. These data indicate a fairly high stability canola varieties Westar plants
near Moscow and to excess zinc content in the medium and their relatively high phytoremediation potential.
Key words: Brassica; zinc; prolin; phytoremediation.
Received June 15, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 100–107
УДК 632.9: 662.73
С.Н. Удинцев1, Т.И. Бурмистрова1, А.В. Заболотская2, Т.П. Жилякова1
1
Сибирский научно-исследовательский институт сельского хозяйства
и торфа Россельхозакадемии (г. Томск)
2
Томский государственный университет (г. Томск)
МЕХАНИЗМЫ ИНДУКЦИИ РЕЗИСТЕНТНОСТИ РАСТЕНИЙ
К ФИТОПАТОГЕНАМ ГУМИНОВЫМИ ВЕЩЕСТВАМИ
В обзоре представлены основные результаты экспериментальных исследований и практического применения гуминовых веществ (ГВ) в качестве индукторов
резистентности растений к фитопатогенам. В качестве ведущего механизма
действия ГВ обсуждается сигнальный путь, в котором принимают участие
ауксин-индолил-3-уксусная кислота и фермент пероксидаза. Данные, представленные в настоящем обзоре, позволяют сформулировать научно обоснованный
подход к разработке высокоэффективных препаратов – индукторов устойчивости растений на основе ГВ, источником которых является, в частности, торф,
ресурсы которого в Томской области одни из самых крупных в мире.
Ключевые слова: индуцированная резистентность растений; фитопатогены; гуминовые вещества; пероксидаза; индолил-3-уксусная кислота; активные
формы кислорода.
Введение
Поиск эффективных препаратов для борьбы с фитопатогенами приобретает все большую актуальность. Так, только в период с 1993 по 2008 г. за
счет болезней зерновых, в первую очередь гнилей, потери зерна в России
превысили 230,6 млн т, что составляет в среднем от 6 до 29% ежегодного валового сбора [1]. Для решения этой проблемы в сельскохозяйственной
практике все более широко применяются препараты третьего поколения
фунгицидов – индукторов устойчивости к патогенам. Подобные препараты,
обладая широким спектром защитных эффектов, не проявляют непосредственного токсического воздействия по отношению к патогену, растениям и
животным и не оказывают негативного воздействия на рост растений [2–3].
Роль пероксидаз в формировании индуцированной
резистентности растений
Согласно современным представлениям, индуцированная резистентность развивается при воздействии на растения элиситоров (индукторов
устойчивости) [3, 4]. Элиситоры активируют комплексную сеть сигнальных
путей, включающую такие регуляторные молекулы, как салициловая и жасмониевая кислоты (SA и JA) и их производные, индолил-3-уксусная кислота
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Механизмы индукции резистентности растений
101
(IAA) и другие соединения, в результате чего индуцируется синтез de novo
белков, связанных с патогенезом (pathogenesis-related proteins, PR), которые
подразделяются, в зависимости от их биохимических и молекулярных особенностей, на 17 субсемейств. Функции PR-белков существенно шире, чем
участие в защитных механизмах: они всегда в определенных количествах
присутствуют в клетках, играя важную роль в различных процессах регуляции роста и развития растений [5–7].
PR-белки реализуют различные механизмы защиты клеток, наиболее
ранним из которых является повышение образования активных форм кислорода (АФК). Среди всех АФК наибольшую роль играет перекись водорода
H2O2, регулирующая в растительной клетке совокупность молекулярных,
биохимических и физиологических реакций. В частности, это соединение
способно инициировать октадеканоидный метаболический путь, ведущий к
биосинтезу JA и ее производных. Незначительное увеличение уровня H2O2
повышает толерантность клеток к стрессу, а гиперпродукция («окислительный взрыв») не только создает высокотоксичное микроокружение, но
и провоцирует локальный ответ, завершающийся апоптозом – формой программируемой смерти клеток в месте инфекции, что в комплексе является
элементами ограничения клеточного распространения патогена либо повышением резистентности клетки к абиотическим стрессам. Таким образом,
H2O2 опосредует взаимодействие между сигнальными путями и сама является сигнальной молекулой, ответственной за перекрестную резистентность
клеток к различным экстремальным воздействиям [8].
Существуют четыре механизма, объясняющие образование H2O2 в растительной клетке. Один из них функционирует на уровне внешней поверхности плазменной мембраны и опосредован PR-белком – ферментом NADPHзависимой оксидазой. Три механизма реализуются на уровне матрикса
клеточной стенки и включают участие пероксидазы, поли(ди)аминоксидазы и оксалат оксидазы. В отличие от последних двух ферментов, которые
участвуют в процессах образования непосредственно перекиси водорода,
NADPH-зависимая оксидаза и пероксидаза катализируют начальное образование аниона супероксида, который далее дисмутирует в H2O2 [9, 10]. Из
всех перечисленных ферментов, участвующих в индукции системной резистентности, наибольший интерес вызывает пероксидаза.
Пероксидаза, а точнее, обширное мультигенное семейство ферментов –
классических пероксидаз растений класса III, содержащих в качестве простетической группы гем b (фотогемин IX) и два иона Ca2+, относят к 9-му
классу PR-белков. Растительные пероксидазы не только аккумулируются
локально в месте инфекции или при воздействии абиотических факторов,
но и экспрессируются системно и, как и другие PR-белки, всегда присутствуют в растениях в определенном количестве. Они участвуют в регуляции
широкого спектра физиологических процессов в течение всего цикла жизни растений благодаря большому количеству изоформ и множественности
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
102
С.Н. Удинцев, Т.И. Бурмистрова, А.В. Заболотская, Т.П. Жилякова
реакций, катализируемых ими. Основная функция пероксидаз – катализировать окисление перекисью водорода H2O2 различных электрон-донорных
субстратов, в первую очередь полифенольной структуры. В то же время при
избытке субстратов, обладающих высоким восстанавливающим потенциалом, пероксидазы начинают проявлять оксигеназную активность, катализируя генерацию H2O2 [11]. В частности, этот феномен имеет место при избытке ауксина-индолил-3-уксусной кислоты (IAA) и обусловлен наличием
в молекуле фермента дополнительного специфического центра связывания
с этим соединением. Подобный механизм формирования индуцированной
резистентности, получивший название IAA-пероксидазный сигнальный
путь, описан сравнительно недавно [12]. В процессе индукции резистентности участие пероксидаз определяется не только генерацией высокотоксичных молекул H2O2, но и установлением структурных барьеров в результате
стимуляции процессов лигнификации и суберизации клеточной оболочки,
формирования перекрестных сшивок полисахаридов стенки клетки, опосредованных окислением их компонента – феруловой кислоты [9].
Показано, что уровень пероксидаз в клетках сортов растений, устойчивых к патогенам, выше, чем восприимчивых. Такие данные получены, в
частности, для картофеля [13] и гороха [14].
Учитывая широкий диапазон эффектов пероксидаз, поиск эффективных индукторов резистентности растений активно ведется среди соединений, способствующих повышению в растительных клетках уровня
этих ферментов. Перспективными для решения задачи рассматриваются
средства природного происхождения [15]. Особый интерес в качестве
источника получения новых эффективных индукторов резистентности,
функционирующих посредством IAA-пероксидазного сигнального пути,
вызывают гуминовые вещества (ГВ), в течение многих лет успешно применяющиеся в растениеводстве. ГВ обладают способностью регулировать метаболизм растительной клетки, влияя на проницаемость мембран,
транспорт ионов, процессы фотосинтеза, синтез АТФ, аминокислот, белков, углеводов и нуклеиновых кислот, регулируя активность многих ферментов [16]. ГВ являются регуляторами роста растений, проявляя ауксиноподобные свойства [17].
Фунгистатические эффекты препаратов на основе ГВ
В литературе имеются многочисленные данные, свидетельствующие о
фунгистатическом эффекте препаратов на основе ГВ. В экспериментах in
vitro препараты ГВ подавляли возбудителей корневой, стеблевой, плодовой
гнилей различных сельскохозяйственных культур: снижали рост мицелия
Fusarium culmorum и Alternaria alternata [18], радиальный рост и герминацию спор F. oxysporum f.sp. melonis и F. oxysporum f.sp. lycopersici [19],
подавляли рост F. solani [20], снижали выраженность ранних проявлений
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Механизмы индукции резистентности растений
103
гнили A. solani [21], подавляли рост мицелия Choanephora cucurbitaru [22].
Ингибирование роста F. oxysporum выявлена при применении препаратов на
основе ГВ, полученных из сфагнового торфа Томской области [23].
В полевых исследованиях препараты на основе ГВ при различных схемах их применения повышали естественную резистентость герани к возбудителям серой гнили Botrytis cinerea [24], огурца – к корневым гнилям
Pythium ps. и антракнозу тыквенных культур Colletotrichum lagenarium [25],
арахиса – к корневым гнилям F. oxysporum Schlecht и возбудителю антракноза Aspergillus niger Vantighn [26], гороха – к корневым гнилям Pythium ultimum [27], картофеля – к A. solani [21], бобовых – к грибам Rhizoctonia solani,
F. solani [28] и возбудителям шоколадной пятнистости листьев, вызываемой
Botrytis fabae Sardine [29], корней мандарина – к гнилям Fusarium sp. [20],
томатов – к Cladosporium fulvum и A. solani [2]. Отмечена более выраженная
степень снижения пораженности возбудителями корневой гнили пшеницы
Helmintosporium sativum, F. oxysporum, A. alternata в условиях Западной Сибири при предпосевной обработке семян и вегетирующих растений препаратом на основе комплекса ГВ торфа [23].
Механизмы действия ГВ как индукторов резистентности
Данные многих исследований позволяют предполагать, что фунгистатический эффект ГВ связан с индукцией ими резистентности растений с участием упомянутого выше IAA-пероксидазного механизма [12]. При обработке
гуматом натрия семян томатов активность пероксидазы у сорта, устойчивого
к C. fulvum и A. solani, возросла в 1,8 раза [2]. Возрастание устойчивости к неблагоприятным факторам при воздействии препаратов ГВ, сопровождающееся
повышением уровня пероксидаз, отмечено у семян гороха [30]. IAA в составе
ГВ впервые были идентифицированы Muscolo A. et al. в 1998 г., и в настоящее
время ауксиноподобный эффект ГВ связывают именно с данным соединением
[31]. Показано, что IAA находится преимущественно во фракциях ГВ с относительно низкой молекулярной массой (<3 500 Да), достигая уровня 37 нмоль
мг–1 углерода [32]. Содержание IAA в среднекислых торфах Томской области
составляет 69,3–120,7 мкг/кг–1 сухой массы, в торфах высокой степени заболоченности достигает 210, низкой степени – 134 мкг/кг–1 сухой массы; наиболее
высокий уровень IAA характерен для вторично трансформированных торфяно-болотистых почв [10, 33]. Более значительно содержание IAA в кислых
почвах по сравнению с щелочными, ГВ которых проявляют преимущественно гиббереллиноподобный эффект [34]. У ГВ, выделенных из кислых почв,
выше показатели отношения углерода к азоту и отношения углерода гуминовых веществ к общему углероду [35].
В культуре растительных клеток ГВ, полученные из кислых почв с наибольшей ауксиноподобной активностью, индуцировали наиболее высокий
уровень активности и полиморфизма пероксидазы [35]. В экспериментах
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
104
С.Н. Удинцев, Т.И. Бурмистрова, А.В. Заболотская, Т.П. Жилякова
in vitro с использованием каллусных культур показано, что способность
стимулировать рост клеток и повышать уровень пероксидазы, сравнимая с
эффектами IAA, зависит как от молекулярной массы ГВ, так и от их структуры. IAA-подобный эффект отмечен преимущественно у фракций ГВ с относительно низкой молекулярной массой (< 3 500 Да), характеризующихся
наличием карбоксильных, пептидных и углеводных групп, остатков органических кислот, бетаина. Фракции с молекулярной массой более 3 500 Да,
содержащие сахароподобные, полиэфирные, фенольные и жирнокислотные
остатки, данного вида активности не проявляли [36–38]. Именно низкомолекулярные фракции ГВ, содержащие преимущественно гидроксильные, хиноидные и карбоксильные группы, обладали наибольшей антифунгальной
активностью [32, 22].
Индукция образования АФК в растениях при воздействии ГВ связана с
наличием у последних прооксидантных свойств. Ди- и тригидроксифенольные и хинонные структуры ГВ вызывают повышение в клетках уровня стабильных радикалов бензосемихинонов, способных повреждать клеточные
структуры патогенов непосредственно либо в результате образования радикала супероксида, который при дефиците фермента супероксиддисмутазы
превращается в перекись водорода H2O2 [7]. Перекись водорода определяет
цитотоксическое действие ГВ, в частности по отношению к возбудителям
Fusarium sp. Trans [39].
Заключение
Таким образом, на основании данного обзора литературы можно сделать
вывод о перспективах применения препаратов на основе ГВ, в том числе
торфа, ресурсы которого в Томской области являются одними из самых крупных в мире, в качестве препаратов для индукции резистентности растений
к фитопатогенам. Эффективность таких препаратов может определяться в
значительной степени воздействием ГВ на такой механизм формирования
резистентности, как образование активных форм кислорода в ходе IAAпероксидазного сигнального пути, и в значительной степени будет зависеть
от молекулярной массы, структуры и состава ГВ.
Литература
1. Санин С.С., Назарова Л.Н. Фитосанитарная обстановка на посевах пшеницы в Российской Федерации (1991–2008 гг.). Аналитический обзор // Защита и карантин растений. 2010. № 2. С. 69–88.
2. Поликсенова В.Д. Индуцированная резистентность растений к патогенам и абиотическим стрессовым факторам (на примере томата) // Вестник БГУ. 2009. сер. 2. № 1.
С. 48–60.
3. Тютерев С.Л. Механизмы действия фунгицидов на фитопатогенные грибы. СПб. :
ИПК «Нива», 2010. 172 с.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Механизмы индукции резистентности растений
105
4. Zhao J., Davis L.C., Verpoorte R. Elicitor signal transduction leading to production of plant
secondary metabolites // Biotechnol. Adv. 2005. Vol. 23. Р. 283–333.
5. Garcia-Brugger A., Lamotte O., Vandelle E. Early signaling events induced by elicitors of
plant defences // Molec. Plant-Microbe Interact. 2006. Vol. 7. Р. 711–724.
6. Scherer N.M., Thompson C.E., Freitas L.B. Patterns of molecular evolution in pathogenesisrelated proteins // Genetics & Molec. Biol. 2005. Vol. 28. Р. 645–653.
7. Loon L.C., Rep M., Pieterse C.M.J. Significance of inducible defence-related proteins in
infected plants // Ann. Rev. Phytopathol. 2006. Vol. 44. Р. 135–162.
8. Neill S.J., Desikan R., Clarke A. Hydrogen peroxide and nitric oxide as signaling molecules
in plants // J. Experim. Botany. 2002. Vol. 53. Р. 1237–1247.
9. Almagro L., Ros L V.G., Belchi-Navarro S. Class III peroxidases in plant defence reactions //
J. Experim. Botany. 2009. Vol. 60(2). Р. 377–390.
10. Szajdak L., Maryganova M. Occurrence of auxin in some organic soils // Agron. Res. 2007.
№ 5(2). Р. 175–187.
11. Passardi F., Zamocky M., Favet J. Phylogenetic distribution of catalase-peroxidases: are
these patches of order in chaos? // Gene. 2007. Vol. 397. Р. 101–113.
12. Газарян И.Г., Хуштульян Д.М., Тишков В.И. Особенности структуры и механизма действия пероксидаз растений // Успехи биологической химии. 2006. Т. 46. С. 303–322.
13. Граскова И.А., Антипина И.В., Потапенко О.Ю., Войников В.К. Влияние патогена на
динамику активности внеклеточной пероксидазы суспензионных клеток картофеля //
J. Stress. Physiology & Biochemistry. 2005. Vol. 1(1). Р. 16–20.
14. Козявина К.Н. Изменение активности антиоксидантной ферментной системы и фрагментации ДНК Pisum sativum L. при апоптозе и некрозе под действием двухвалентных ионов магния и экстракта триходермы : автореф. … канд. биол. наук. Воронеж,
2010. 24 с.
15. Wedge D.E., Smith B.J. Discovery and evaluation of natural product-based fungicides for
disease control of small fruits // Disease management of fruits and vegetables. Springer
Netherlands, 2006. Vol. 2. Р. 1–14.
16. Pflug W., Ziechman W. Humic acids and disruption of bacterial cell wall by isozyme // Soil
Boil Biochem. 1982. Vol. 14. Р. 165–166.
17. Шаповал О.А., Вакуленко В.В., Прусакова Л.Д. Регуляторы роста растений // Защита и
карантин растений. 2008. № 12. С. 53–88.
18. Moliszewska E., Pisarek T. Influence of humic substances on the growth of two phytopathogenic soil fungi // Environ. Int. 1996. Vol. 22. Р. 579–584.
19. Loffredo E., Mariagrazia B., Fedele C., Nicola S. In vitro assessment of the inhibition of
humic substances on the growth of two strains of Fusarium oxysporum // Cooper. J. Intern.
Soc. Soil. Sci. 2007. Vol. 1. Р. 1–18.
20. El-Mohamedy R. S.R., Ahmed M.A. Effect of Biofertilizers and Humic Acid on control
of Dry Root Rot Disease and Improvement Yield Quality of Mandarin (Citrus reticulate
Blanco) // Research J. Agric. & Biol. Sci. 2009. Vol. 5(2). Р. 127–137.
21. Abd-El-Kareem F., Abd-El-Latif F. M., Fotouh Y.O. Integrated Treatments Between Humic
Acid and Sulfur for Controlling Early Blight Disease of Potato Plants under Field Infection
// Res. J. Agric. & Biol. Sci. 2009. Vol. 5(6). Р. 1039–1045.
22. Siddiqui Y., Meon S., Ismail R. In vitro fungicidal activity of humic acid fraction from oil
palm compost // Int. J. Agric. Biol. 2009. Vol. 11. Р. 448–452.
23. Сысоева Л.Н., Бурмистрова Т.И., Трунова Н.М. Применение продуктов переработки
торфа в качестве индукторов защиты растений от грибных инфекций // Химия растительного сырья. 2008. № 1. С. 123–126.
24. Scheuerell S.J., Mahaffee W.H. Variability associated with suppression of Gray Mold
(Botrytis cinerea) on Geranium by foliar applications of nonaerated and aerated compost
teas // Plant. Dis. 2006. Vol. 90. P. 1201–1208.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
106
С.Н. Удинцев, Т.И. Бурмистрова, А.В. Заболотская, Т.П. Жилякова
25. Hoitink H.A.J., Ramos L.Z. Disease suppression with compost: history, principles and
future // Intern. Conf. «Soil & Compost Eco Biology». Leon – Spain, 2004. Р. 185–198.
26. Ziedan H.E. Soil treatment with biofertilizers for controlling peanut rot and pod Rot diseases in Nobaria Province // Egypt J. Phytopathol. 2000. Vol. 28. P. 17–26.
27. Pascual J.A., Garcia G., Hernandez T., Lynch I. Effectiveness of municipal waste compost and its humic fraction in suppressing Pythium ultimo // Microb. Ecol. 2002. Vol. 44.
P. 59–68.
28. Abd-El-Kareem F. Induced Resistance in Bean Plants Against Root Rot and Alternaria
Leaf Spot Diseases Using Biotic and Abiotic Inducers under Field Conditions // Res.
J. Agric. & Biol. Sci. 2007. Vol. 3(6). Р. 767–774.
29. El-Ghamry A.M., El-Hai K.M.A., Ghoneem K.M. Amino and Humic Acids Promote
Growth, Yield and Disease Resistance of Faba Bean Cultivated in Clayey Soil // Australian
J. Basic. & App. Sci. 2009. Vol. 3(2). Р. 731–739.
30. Юшкова Е.И. Биологическая активность гуминового комплекса различного происхождения и его влияние на рост и развитие растений : дис. … д-ра биол. наук. Воронеж, 2010. 356 с.
31. Muscolo A., Cutrupi S., Nardi S. IAA detection in humic substances // Soil Biology and
Biochemistry. 1998. Vol. 30(8–9). Р. 1199–1201.
32. Quaggiotti S., Ruperti В., Pizzeghello D. Effect of low molecular size humic substances on
nitrate uptake and expression of genes involved in nitrate transport in maize (Zea mays L.)
// J. Experim. Botany. 2004. Vol. 398. Р. 803–813.
33. Szajdak L., Maryganova V. Quantities of indole-3-acetic acid in secondary transformed
peat-moorsh soils // Вестник ТГПУ. 2008. Вып. 4 (78). С. 34–38.
34. Pizzeghello D., Nicolini G., Nardi S. Hormone-like activity of humic substances in Fagus
sylvaticae forests // New Phytologist. 2001. Vol. 151 (3). Р. 647–657.
35. Pizzeghello D., Nicolini G., Nardi S. Hormone-like activities of humic substances in different forest ecosystems // New Phytologist. 2002. Vol. 155 (3). Р. 393–402.
36. Muscolo A., Sidari M., Attinà E. Biological Activity of Humic Substances Is Related to
Their Chemical Structure // Soil Sci. Soc. Am. J. 2007. Vol. 71. Р. 75–85.
37. Muscolo A., Sidari M., Francioso O. The Auxin-like Activity of Humic Substances is
Related to Membrane Interactions in Carrot Cell Cultures // J. Chem. Ecol. 2007. Vol. 33.
Р. 115–129.
38. Muscolo A., Sidari M. Carboxyl and Phenolic Humic Fractions Affect Pinus Nigra Callus
Growth and Metabolism // Soil. Sci. Soc. Am. J. 2009. Vol. 73. Р. 1119–1129.
39. Saito M., Ichinoi M., Tsuruta O. Usefulness of gel electrophoresic comparison of peroxidase for identification of Fusarium spp. Trans // Mycol. Soc. Japan. 1980. Vol. 21.
Р. 229–235.
Поступила в редакцию 11.04.2011 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Механизмы индукции резистентности растений
107
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 100–107
Sergey N. Udintsev1, Tatiana I. Burmistrova1, Anastasiya V. Zabolotskaya2,
Tatiana P. Zhilyakova1
Тhe State Scientific Institution “Siberian Research Institute of Agriculture and Peat
of Russian Academy of Agricultural Sciences”, Tomsk, Russia
2
Tomsk State University, Tomsk, Russia
1
THE MECHANISMS OF INDUCTION OF PLANTS RESISTANCE
TO PHYTOPATOGENS WITH HUMIC SUBSTANCES
The data of modern domestic and foreign scientific literature devoted to one of
the most topical problems of agricultural science – the development of effective
preparations of the new generation to struggle with phytopathogens – the inducers
of plants resistance, is presented in a review. The effect of elicitors – the inductors
of resistance which activates the net of signal ways, including auxin-indolil-3-acetic
acid (IAA) and inducing the synthesis of pathogenesis-related proteins (PR-protein) is
discussed as a basic mechanism of the following phenomenon. One of these mechanisms
is examined – the increasing of reactive oxygen species formation, H2O2, in a first place
with the participation of one of PR-proteins families – the cells peroxydases enzymes.
The level of ones is known to be higher in cells of plants species resistant to pathogens,
then in sensitive ones. The activity of plant peroxidases was shown to be increased at
the abundance of IAA and this mechanism – AA-peroxydase signal way ‒ is discussed
in a review.
As one of the compounds which activate the following signal way, the humic (HS)
substances are presented. The latter are known to possess the auxin-like effect connected
with the presence of IAA in the structure and the possibility to induce the peroxydases
formation in plants cells. The results of experimental and practical investigations
of HS application confirming the ability of ones to induce the plants resistance to
phytopathogens of Fusarium, Alternaria, Choanephora, Aspergillus, Rhizoctonia etc
species are presented. The preparation on the basis of peat HA was shown to decrease
the infection level of wheat root rots in the conditions of West Siberia.
The mechanisms of these effects discussed from the point of view of HS participation in
a IAA – peroxydase signal way. The dependence of this effect from IAA content in different
fractions of HS, the molecular mass of ones, the presence of definite chemical groups and
physico-chemical characteristics of HS source (soil, peat) discussed as well.
The data, presented in a following review, allows to formulate the scientifically
based approach to the development of highly effective preparations – inducers of plants
resistance on the basis of HS of peat origin, in particular. The resource of this mineral
raw material in Tomsk region are known to be one of the greatest in the world.
Key words: induced resistance of plants; phytopatogens; humic substances;
peroxidase; indolil-3-acetic acid; reactive oxygen substances.
Received April 11, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 108–112
УДК 581.1
Д. Хасан1, И.С. Ковтун2, М.В. Ефимова2
Российский университет дружбы народов (г. Москва)
Биологический институт Томского государственного университета (г. Томск)
1
2
ВЛИЯНИЕ ХЛОРИДНОГО ЗАСОЛЕНИЯ НА ПРОРАСТАНИЕ
СЕМЯН И РОСТ ПРОРОСТКОВ Brassica napus L.
Исследования выполнены при финансовой поддержке РФФИ
(грант моб_ст-11-04-90785), а также в рамках проекта ФЦП
«Организационно-техническое обеспечение проведения международной
научной школы «Перспективные направления физико-химической биологии
и биотехнологии» (ГК № 14.741.12.0153 от 07 июня 2011 г.).
Исследовано действие разных концентраций NaCl (от 50 до 200 мМ) на
прорастание и морфогенез проростков рапса в темноте. Процент проросших семян и ростовые показатели проростков (длина гипокотиля и корня)
оценивали на 3,5 и 7-е сут после прорастания в условиях засоления. Негативный эффект, вызванный непродолжительным действием избытка соли
(3,5 сут), был выражен значительно сильнее, чем при длительном засолении.
Наибольшую чувствительность к действию непродолжительного засоления
проявляли гипокотили проростков рапса. Высокая солеустойчивость отмечена для процесса прорастания семян по сравнению с процессом роста корневой
системы и гипокотиля.
Ключевые слова: Brassica napus L.; засоление; гипокотиль; корень; прорастание семян.
Введение
Изучение механизмов устойчивости растений к повреждающему действию абиотических факторов является одной из фундаментальных проблем биологии. Ее решение имеет принципиальное значение для понимания
стратегии выживания растений в экстремальных условиях, прежде всего в
условиях интенсивного засоления. Актуальность данной проблемы определяется тем, что в настоящее время 25% всех почв земного шара в той или
иной степени засолено [1–3]. Засоление территорий, чему во многом способствуют неблагоприятные глобальные изменения климата, приводит к
снижению продуктивности агро- и биоценозов, падению биоразнообразия
и, как следствие, значительным экономическим потерям [4–10].
Цель данного исследования – оценка влияния хлоридного засоления на
прорастание семян и рост проростков Brassica napus L.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние хлоридного засоления на прорастание семян
109
Материалы и методики исследования
В качестве объекта исследований использованы растения рапса Brassica
napus L. В ходе исследований изучено действие различных концентраций
NaCl (от 50 до 200 мМ) на прорастание и морфогенез проростков рапса в
темноте. Процент проросших семян и ростовые показатели проростков
(длина гипокотиля и корня) анализировали на 3,5 и 7-е сутки после прорастания в условиях засоления.
Статистическая обработка данных проведена с помощью пакета прикладных программ StatSoft STATISTICA 6.0. Результаты экспериментов
представлены в виде средних арифметических со стандартными ошибками.
Статистическую значимость различий рассчитывали для 95%-го уровня значимости (р<0,05).
Результаты исследования и обсуждение
При засолении наблюдались подавление прорастания семян и ингибирование растяжения осевых органов проростков рапса. При этом негативный
эффект, вызванный непродолжительным действием избытка соли (3,5 сут),
был выражен значительно сильнее, чем при длительном засолении (7 сут)
(рис. 1).
Рис. 1. Ростовые показатели проростков рапса на 3,5 сут
Наибольшую чувствительность к действию непродолжительного засоления проявляли гипокотили проростков рапса. В этом случае ингибирование
роста гипокотилей обнаруживали при 50 мМ NaCl.
В то же самое время торможение роста корней наблюдали лишь под действием более высоких концентраций соли (75 или 100 мМ). Увеличение продолжительности засоления до 7 сут существенно меняло картину, поскольку
в данном случае рост корней рапса ингибировался при 50 мМ, в то время
как торможение роста гипокотилей обнаруживалось при 125 мМ NaCl. Это
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
110
Д. Хасан, И.С. Ковтун, М.В. Ефимова
означает, что при длительном засолении в первую очередь повреждается
корневая система, а затем – надземные органы. При этом процесс прорастания семян оказался достаточно устойчивым к засолению. Выраженное
ингибирование прорастания проявлялось при 100–175 мМ NaCl. Число проросших семян при продолжительном засолении (7 сут) в широком диапазоне
концентраций NaCl (100 до 175 мМ) возрастало.
На этом основании можно заключить, что наличие соли в среде лишь
замедляло процесс прорастания семян, а не вызывало их гибель в первые
3,5 сут воздействия. Напротив, при 200 мМ прорастание семян было полностью подавлено (рис. 2).
3,5 сут
7 сут
Рис. 2. Прорастание семян рапса
Заключение
Таким образом, процесс прорастания семян рапса оказался более солеустойчивым по сравнению с процессом роста корневой системы и гипокотиля. При этом реакция проростков рапса на различные концентрации
соли характеризовалась органоспецифичностью. Снижение ингибирующего влияния хлорида натрия при продолжительном засолении, вероятно,
обусловлено тем, что растения постепенно адаптировались, что сопровождалось формированием защитных механизмов и повышением их солеустойчивости.
Литература
1. Kuznetsov Vl.V., Shevyakova N.I. Polyamines and Plant Adaptation to Saline Environments //
Desert Plants. Heidelberg, Dordrecht, London, New York : Springer-Verlag, 2010. P. 261–298.
2. Kholodova V., Volkov K., Kuznetsov Vl. Plants under Heavy Metal Stress in Saline Environments // Soil Heavy Metals. Ser. «Soil Biology». 19, Heidelberg, Dordrecht. London ; New
York : Springer-Verlag, 2010. P. 163–183.
3. Иванов Ю.В., Карташов А.В., Савочкин Ю.В. Устойчивость всходов Pinus silvestris и
Picea abies к солевому стрессу // Лесной вестник. 2010. № 3(72). С. 119–122.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние хлоридного засоления на прорастание семян
111
4. Шевякова Н.И., Бакулина Е.А., Кузнецов Вл.В. Антиоксидантная роль пролина у галофита Mesembryanthemum crystallinum при действии засоления и параквата, инициирующих окислительный стресс // Физиология растений. 2009. № 5. С. 736–742.
5. Гринин А.Л., Холодова В.П., Кузнецов Вл.В. Сравнительный анализ физиологических механизмов солеустойчивости различных сортов горчицы // Вестник Российского университета дружбы народов. Сер. Агрономия и животноводство.
2010. № 1. С. 27–38.
6. Стеценко Л.А, Ракитин В.Ю., Шевякова Н.И., Кузнецов Вл.В. Органоспецифическое
изменение содержания свободных и коньюгированных полиаминов в растениях
Mesembryanthemum crystallinum при засолении // Физиология растений. 2009. Т. 56.
С. 893–898.
7. Шевякова Н.И., Мусатенко Л.И, Стеценко Л.А. и др. Влияние засоления на содержание полиаминов и фитогормонов в проростках Phaseolus vulgaris L. // Доповįдį НАН
Украįни (Доклады НАН Украины). 2009. Т. 12. С. 180–185.
8. Карташов А.В., Радюкина Н.Л., Иванов Ю.В. и др. Роль систем антиоксидантной защиты при адаптации дикорастущих видов растений к солевому стрессу // Физиология растений. 2008. № 4. С. 516–522.
9. Баят Ф., Ширан Б., Беляев Д.В. и др. Повышенная устойчивость к засолению растений
картофеля, трансформированных геном вакуолярного Na+/H+-антипортера ячменя
HvNHX2 // Физиология растений. 2010. Т. 57. С. 744–755. 10. Радюкина Н.Л., Мапелли С., Иванов Ю.В. и др. Гомеостаз полиаминов и антиоксидантные системы корней и листьев Plantago major L. при солевом стрессе // Физиология растений. 2009. Т. 56. С. 359–368.
Поступила в редакцию 29.06.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 108–112
Djalal Hasan1, Irina S. Kovtun2, Marina V. Efimova2
Peoples’ Friendship University of Russia, Moscow, Russia
Biological Institute of Tomsk State University, Tomsk, Russia
1
2
THE INFLUENCE OF CHLORIDE SALINIZATION ON SEEDS
GERMINATION AND SEEDLINGS GROWTH OF Brassica napus L.
Rape (Brassica napus L.) has a grate practical interest. This plant widely used
not only in food industry, but in technical production. The most common negative
abiotic factor is a solinization of soil, which takes 25 percents of all soils of the world.
Accumulation of salt in soil may lead to yield reduction, and, as a result, to significant
economic losses.
The influence of different concentration of NaCl (from 50 to 200 mM) on rape
seedlings germination and morphogenesis in darkness were researched. Percentage of
germinated seeds and growth rates (the length of hypocotyl and root) were analyzed on
3,5 and 7th day after germination under saline conditions.
Under salt stress the suppression of seeds germination and inhibition of axial
organs elongation were observed. The negative effect of short salinity (3,5 days)
were more pronounced than under long-term salinity (7 days). The hypocotyls of rape
seedlings were most sensitive to short salt action. In this case the inhibition of hypocotyl
growth were observed under 50 mM NaCl. Also, the roots growth inhibition was noted
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
112
only under higher salt concentration (75 and 100 mM). Elongation of salt action to
7 days significantly changed the picture, because in this case the root growth of the
rape seedlings was inhibited under 50 mM, while the growth inhibition of hypocotyls
was detected under 125mM. It means, that primarily damaged the root system and
afterwards the aerial organs under long-term salinity. At the same time, the process
of seeds germination was sufficiently resistant to salinity. Expressed inhibition of
germination was showed under 100–175 NaCl. The quantity of germinated seeds under
long-term salinity (7 days) at a wide range of concentrations NaCl (100–175 mM)
increased. On this basis we can conclude that salt presence in the medium only slowed
the seeds germination and didn’t cause it death in the early days of impact of salt.
However, under 200 mM the seeds germination was completely suppressed.
So, the seeds germination process was more salt-tolerant than hypocotyl and root
system growth process. Also, the rape seedlings reaction on different salt concentrations
characterized by the organ specificity. Decrease of inhibition influence of NaCl under
long-term salinity, probably connected with adaptation of plants and with creation of
protective mechanisms and improvement of their salt-tolerance.
Key words: Brassica napus L.; salinization; hypocotyl; root; seeds germination.
Received June 29, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 113–123
ФИЗИОЛОГИЯ ЧЕЛОВЕКА И ЖИВОТНЫХ
УДК 57.043, 537.868, 53.043, 59.085,
И.Р. Князева1, 3, В.В. Иванов1, Л.П. Жаркова2, 3,
О.П. Кутенков3, В.В. Ростов3, М.А. Большаков2, 3
Сибирский государственный медицинский университет (г. Томск)
Биологический институт Томского государственного университета (г. Томск)
3
Институт сильноточной электроники СО РАН (г. Томск)
1
2
ВЛИЯНИЕ ИМПУЛЬСНО-ПЕРИОДИЧЕСКОГО
МИКРОВОЛНОВОГО ИЗЛУЧЕНИЯ
НА ФУНКЦИОНАЛЬНУЮ АКТИВНОСТЬ
ИЗОЛИРОВАННЫХ МИТОХОНДРИЙ ПЕЧЕНИ МЫШЕЙ
Работа выполнена в рамках АВЦП «Развитие научного потенциала
высшей школы (2011 г.)» (проект № 2.1.1/13778).
Исследовано влияние импульсно-периодического микроволнового излучения
с частотой повторения импульсов в диапазоне 8–22 имп./с и интенсивностью
воздействия от 70 до 1 500 Вт/см2 в импульсе на функциональную активность
изолированных митохондрий печени мышей по скорости потребления кислорода
в различных метаболических состояниях по Чансу. Показано, что однократное
воздействие 4 000 импульсов сопровождалось изменением скорости потребления
кислорода в фосфорилирующем и нефосфорилирующем состояниях и снижением
степени сопряжения процессов окисления и фосфорилирования. Результат зависел от частоты повторения импульсов и интенсивности воздействия. Рассмотрены возможные механизмы влияния микроволновых импульсов на функциональное состояние митохондрий.
Ключевые слова: импульсно-периодическое микроволновое излучение; дыхание митохондрий печени.
Введение
Изучение вопроса о биологическом действии мощных микроволновых
импульсов наносекундной длительности обусловлено необходимостью
оценки воздействия излучений с высокой пиковой плотностью потока мощности (пППМ) при относительно низком среднем уровне, не превышающем
гигиенические нормативы безопасного воздействия. При этом самое пристальное внимание уделяется установлению первичных механизмов и общих закономерностей влияния данного фактора на живые объекты.
К настоящему времени известно, что импульсно-периодическое микроволновое излучение (ИПМИ) оказывает выраженное биологическое действие. Оно способно инициировать изменение морфологических и био-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
114
И.Р. Князева, В.В. Иванов, Л.П. Жаркова и др.
химических показателей крови и печени крыс и мышей [1–3], изменять
пролиферативную активность опухолевых и нормальных клеток [4, 5], электропроводности в суспензиях клеток, в частности эритроцитов, митохондриях [6], а также цельной крови [7]. Одним из предполагаемых механизмов
влияния микроволновых импульсов наносекундной длительности может
быть изменение уровня активных форм кислорода (АФК) с последующей
окислительной модификацией липидов и белков клеток [8]. Поскольку одним из основных источников АФК в клетке является дыхательная цепь митохондрий [9], именно эти субклеточные структуры можно рассматривать
как первичные мишени биологического действия ИПМИ.
Целью настоящей работы являлось изучение влияния импульсно-периодического микроволнового излучения на изменение функционального состояния митохондрий, оцененное по скорости потребления кислорода митохондриями в различных метаболических состояниях.
Материалы и методики исследования
Эксперименты проведены на изолированных методом дифференциального
центрифугирования митохондриях из печени беспородных белых мышей-самцов массой 25–30 г. Мыши содержались в стандартных условиях при постоянной температуре и влажности в условиях светового режима 12:12, корм и
питье были доступны в любое время суток. Содержание животных в виварии и
все манипуляции, связанные с забором материала и выделением субклеточных
фракций, проводились в соответствии с санитарными правилами по устройству, оборудованию и содержанию экспериментально-биологических клиник,
а также основывались на положениях Хельсинской декларации Всемирной
медицинской ассоциации от 1964 г., дополненной в 1975, 1983 и 1989 гг. [10].
Забор ткани печени и выделение субклеточных фракций проводились
при температуре от 0 до +4°С. Необходимые реактивы готовились на бидистиллированной воде. Для получения изолированных митохондрий из печени мышей использовалась методика Джонсона и Лэрди [11] с небольшими
модификациями. Печень освобождалась от крови путем перфузии in situ,
охлажденной до 0°С средой выделения, содержащей 0,3 М раствор сахарозы, 1 мМ раствор ЭДТА, 10 мМ Трис-буфер (pH 7,4). Навеска печени 1,5 г
измельчалась в гомогенизаторе Поттера. Для удаления не полностью разрушенных клеток и ядер гомогенат центрифугировался 5 мин при 5 000 g
(0...+2°С) на рефрижераторной центрифуге ЦРЛ-1 (Россия). Надосадок центрифугировался при 10 000 g 5 мин (0...+2°С), осадок митохондрий тщательно ресуспендировался в среде, содержащей 0,3 М сахарозы и 20 мМ трисбуфер (рН 7,4). Полученная суспензия митохондрий хранилась на тающем
льду на протяжении всего эксперимента.
Функциональное состояние митохондрий определялось по скорости потребления кислорода. Для этого использовался совместимый с персональ-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние импульсно-периодического микроволнового излучения
115
ным компьютером измеритель кислорода АКПМ-02Л (Россия), снабженный
амперометрическим сенсором АСрО2-01 (Россия), и полярографическая
ячейка объемом 1,3 мл. Ячейка заполнялась средой инкубации, насыщенной
кислородом и содержащей 250 мМ сахарозы, 2,5 мМ МgCl2 и 5 мМ КН2РО4
(рН 7,4). После установки электрода в ячейку вносилась суспензия митохондрий (50 мкл), содержащая 0,7–1,0 мг белка. Скорость дыхания выражалась
в нмоль О2/мин на мг белка. Содержание белка в пробах суспензии митохондрий определялось по Бредфорду [12].
Измерение скорости потребления кислорода изолированными митохондриями проводилось в различных состояниях по Чансу [13]:
V0 – эндогенное дыхание в состоянии 1 по Чансу (скорость потребления
кислорода клетками на эндогенных субстратах);
V2(V4S) – скорость дыхания в состоянии 2 и 4 по Чансу (при содержании
в среде инкубации 5 мМ сукцината (субстрат комплекса II) при отсутствии
АДФ);
V3 – скорость дыхания в состоянии 3 по Чансу (условия те же, что и при
определении V4, но в присутствии 200 мкМ АДФ; при этом фактором, лимитирующим скорость реакции, является сама дыхательная цепь).
Для оценки эффективности работы дыхательной цепи рассчитывалось
отношение скорости фосфорилирующего дыхания к скорости нефосфорилирующего дыхания, по величине которого можно судить о степени сопряженности окисления и фосфорилирования, а также о степени интактности
митохондриальных препаратов [13].
Суспензия митохондрий подвергалась однократному воздействию
4 000 микроволновых импульсов с частотами повторения в диапазоне
8–22 имп./с. Опыты проводились в одно и то же время (в утренние часы).
Источником ИПМИ служил лабораторный импульсный генератор на основе магнетрона МИ-505 (Россия, несущая частота 10 ГГц, выходная пиковая
мощность 180 кВт, длительность импульсов 100 нс). Облучение проводилось из открытого конца волновода сечением 10 × 33 мм. Интенсивность
воздействия оценивалась по величине пиковой плотности потока мощности,
которая в данном исследовании составляла от 70 до 1 500 Вт/см2. Измерение
характеристик микроволновых импульсов проводилось согласно методике,
описанной в ранее опубликованных работах [14]. Выбор параметров воздействия основывался на результатах ранее проведенных экспериментов по изучению эффектов действия импульсно-периодического микроволнового излучения на окислительные процессы в крови и печени мышей и крыс [1–3].
В работе использовались облученные и ложнооблученные суспензии митохондрий, которые подвергались аналогичным манипуляциям, что и облученные,
но без включения источников излучения. Для каждого из режимов воздействия
было выполнено одинаковое количество экспериментов (по 5–6 повторностей).
Измеренные скорости дыхания и вычисленный коэффициент дыхательного
контроля подвергались статистической обработке, при которой рассчитыва-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
116
И.Р. Князева, В.В. Иванов, Л.П. Жаркова и др.
лись средняя арифметическая величина показателя и ее стандартная ошибка.
Статистическая обработка результатов производилась с использованием пакета программ StatSoft STATISTICA 6.0. Статистическая значимость различий
между показателями облученных и ложнооблученных выборок определялась с
помощью непараметрического U-критерия Манна – Уитни [15].
Результаты исследований
В результате проведенных экспериментов было показано, что скорость
потребления кислорода митохондриями в присутствии эндогенного субстрата (в метаболическом состоянии 1 по Чансу) не изменялась после воздействия импульсно-периодического микроволнового излучения всех используемых интенсивностей и частот повторения импульсов (рис. 1, а).
Добавление к суспензии облученных митохондрий субстрата дыхания
(5 ммоль сукцината) переводило митохондрии в состояние 2 и характеризовалось повышением скорости потребления кислорода в два раза по отношению к группе ложного облучения. Воздействие с пППМ 70 Вт/см2 при
частотах 8 и 13 имп./с, с пППМ 700 Вт/см2 при частотах 8 и 22 имп./с и с
пППМ 1500 Вт/см2 при частоте 22 имп./с. Облучение митохондрий ИПМИ
с остальными параметрами оказалось неэффективным в отношении изменения скорости потребления кислорода в состоянии 2 в присутствии экзогенного субстрата сукцината и в отсутствии синтеза АТФ (рис. 1, б).
Добавление АДФ к суспензии облученных митохондрий в присутствии
экзогенного субстрата переводило митохондрии в состояние 3 и приводило
к резкому повышению скорости потребления кислорода, которая снижалась
после исчерпания АДФ (рис. 2). Воздействие ИПМИ на митохондрии в метаболическом состоянии 3 по Чансу в большинстве случаев увеличивало скорость потребления кислорода, и эффект зависел от пиковой ППМ и частоты
повторения импульсов. После воздействия ИПМИ с пППМ 70 Вт/см2 уровень
дыхания митохондрий увеличивался при всех частотах повторения импульсов
за исключением частоты 10 имп./с. Воздействие ИПМИ с пППМ 700 Вт/см2
увеличило интенсивность дыхания в состоянии 3 при частотах повторения 8,
10 и 22 имп./с, в то время как воздействие с пППМ 1 500 Вт/см2 увеличивало
скорость потребления кислорода только после облучения с частотой 22 имп./с.
Остальные частоты повторения импульсов оказались неэффективными. Эти
результаты свидетельствуют о наличии стимулирующего влияния ИПМИ на
изолированные энергизованные митохондрии (состояние 3 по Чансу).
Влияние ИПМИ на эффективность работы дыхательной цепи было оценено по изменению рассчитанного коэффициента дыхательного контроля
(отношение скорости фосфорилирующего к скорости нефосфорилирующего дыхания). Проведенные эксперименты показали (рис. 3), что коэффициент дыхательного контроля, отображающего степень сопряжения процессов окисления и фосфорилирования после воздействия микроволновых
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние импульсно-периодического микроволнового излучения
117
Скорость потребления кислорода
Скорость потребления кислорода
в состоянии 1, нмоль О2/(мин*мг
в состоянии 1, нмоль О2/(мин • мг белка)
белка)
импульсов, увеличивается только после воздействия с пППМ 1 500 Вт/см2 с
частотой повторения 10 имп./с. Во всех остальных случаях дыхательный коэффициент либо не изменялся (в большинстве из облученных групп), либо
значимо снижался, как после воздействия с пППМ 70 Вт/см2 при частотах
8, 10 и 13 имп./с, а также после воздействия с пППМ 700 Вт/см2 при частоте
8 имп./с (рис. 4). Это не противоречит возможности стимуляции дыхания и
в то же время указывает на то, что не весь утилизированный кислород был
использован для синтеза АТФ.
2
70
70 Вт/см
Вт/см2
12
Вт/см2
700 Вт/см2
1 500
Вт/см2
1500 Вт/см2
10
8
6
4
2
0
8
10
13
16
22
Частота повторения импульсов, имп./с
Частота пов торения импуль сов , имп./с
Скорость потребления кислорода
Скорость
потребления
кислорода
в состоянии
2, нмоль
О2/(мин*мг
в состоянии 2, нмоль О2/(мин • мг белка)
белка)
а
2
70
70 Вт/см
Вт/см2
40
1 500
Вт/см2
1500 Вт/см2
*
35
*
30
25
2
700
700 Вт/см
Вт/см2
*
*
*
20
*
*
*
15
10
5
0
8
10
13
16
22
Частота повторения импульсов, имп./с
Частота пов
б торения импуль сов , имп./с
Рис. 1. Влияние импульсно-периодического микроволнового излучения с пиковой
плотностью потока мощности 70, 700 и 1 500 Вт/см2 и частотами повторения
8–22 имп./с на скорость потребления кислорода митохондриями в присутствии
эндогенного субстрата (в метаболическом состоянии 1 по Чансу) (а) и после
добавления экзогенного субстрата дыхания сукцината (в метаболическом
состоянии 2 по Чансу) (б). Здесь и далее на рисунках штриховой полосой
обозначен 95%-ный доверительный интервал значений для группы
ложного облучения; звездочкой обозначены статистически значимые различия
между показателями облученной и ложнооблученной выборок (р ≤ 0,05)
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
И.Р. Князева, В.В. Иванов, Л.П. Жаркова и др.
Скорость потребления кислорода
Скорость
потребления
в состоянии
3 нмолькислорода
О2/(мин*мг
в состоянии 2, нмоль
О2/(мин • мг белка)
белка)
118
2
70
70 Вт/см
Вт/см2
80
70
*
2
700
700Вт/см
Вт/см2
2
1 500
1500 Вт/см
Вт/см2
*
*
*
*
*
*
60
*
50
40
30
20
10
0
8
10
13
16
22
Частота повторения импульсов, имп./с
Частота пов торения импуль сов , имп./с
Рис. 2. Изменение скорости потребления кислорода митохондриями
в присутствии экзогенного субстрата дыхания сукцината и АДФ (состояние 3
по Чансу) после воздействия импульсно-периодического микроволнового
излучения с пиковой плотностью потока мощности 70, 700 и 1 500 Вт/см2
и частотой повторения 8–22 имп./с
2
70
70 Вт/см
Вт/см2
Коэффициент ды хатель ного
контроля
7,00
2
700
700Вт/см
Вт/см2
2
1 500
1500Вт/см
Вт/см2
*
6,00
5,00
4,00
3,00
2,00
*
*
*
*
1,00
0,00
8
10
13
16
Частота повторения импульсов, имп./с
22
Частота пов торения импуль сов , имп./с
Рис. 3. Изменение величины коэффициента дыхательного контроля после
воздействия импульсно-периодического микроволнового излучения
с пиковой плотностью потока мощности 70, 700 и 1 500 Вт/см2 и частотой
повторения 8–22 имп./с
Анализ полученных результатов
Как показали эксперименты, воздействие импульсно-периодического
микроволнового излучения с пППМ от 70 до 1 500 Вт/см2 может изменять
скорость дыхания митохондрий на экзогенном субстрате (5 ммоль сукцината) и в фосфорилирующем состоянии. Изменение функционального состояния митохондрий после воздействия ИПМИ зависело от частоты повторения
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние импульсно-периодического микроволнового излучения
119
импульсов и интенсивности излучения. Наиболее эффективными оказались
воздействия с интенсивностями 70 и 700 Вт/см2 и частотами 8, 10 и 22 имп./с.
В то же время коэффициент дыхательного контроля, отражающий степень
сопряжения процессов окисления и фосфорилирования, увеличивался только при максимальной из использованных интенсивностей (1 500 Вт/см2) и
частоте 10 имп./с. После воздействия с более низкой интенсивностью излучения величина коэффициента дыхательного контроля уменьшалась. Это
указывает на ухудшение функционального состояния митохондрий с точки
зрения уменьшения степени сопряжения окисления и фосфорилирования и
снижения возможности продукции АТФ.
Из полученных результатов следует, что митохондрии после воздействия
ИПМИ с различными параметрами могут реагировать несколькими вариантами изменения интенсивности процессов дыхания и фосфорилирования:
1. Стимуляция дыхания при уменьшении степени сопряжения окисления
и фосфорилирования. Это должно сопровождаться уменьшением продукции
АТФ вследствие снижения активности Н+-АТФ-синтетазы [15]. Стимуляция
дыхания при уменьшении степени сопряжения окисления и фосфорилирования может быть обусловлена открытием пор неспецифической проводимости [16]. В этом случае происходит снижение протонного градиента, для
восстановления которого будет расходоваться АТФ. Такого рода процессы
реализуются после воздействия ИПМИ с пППМ 70 Вт/см2 при частотах повторения 8, 13 и 22 имп./с и с пППМ 700 Вт/см2 при частоте 8 имп./с.
2. Отсутствие стимуляции или торможения дыхания при повышении степени сопряжения окисления и фосфорилирования. Это может происходить
за счет активации АТФ-синтетазы с соответствующим увеличением продукции АТФ [17]. Такого рода процессы реализуются только после воздействия
ИПМИ с пППМ 1 500 Вт/см2 при частоте повторения 10 имп./с.
3. Стимуляция дыхания при неизменной степени сопряжения окисления
и фосфорилирования. Это может происходить при увеличении скорости потребления кислорода в фосфорилирующем и нефосфорилирующем состояниях. Такого рода процессы реализуются после воздействия ИПМИ с пППМ
70 Вт/см2 при частоте повторения 16 имп./с, с пППМ 700 Вт/см2 при частотах 10 и 22 имп./с и с пППМ 1 500 Вт/см2 при частоте повторения 22 имп./с.
4. Отсутствие стимуляции или торможения дыхания при неизменной степени сопряжения окисления и фосфорилирования свидетельствует об отсутствии влияния на функциональное состояние митохондрий. Такого рода
процессы реализуются после воздействия ИПМИ с пППМ 700 Вт/см2 при
частотах 13 и 16 имп./с и с пППМ 1 500 Вт/см2 при частотах повторения 8,
13 и 16 имп./с.
Каковы могут быть причины изложенных вариантов реагирования митохондрий на воздействие ИПМИ? Можно предположить, что одной из причин
повышения потребления кислорода митохондриями печени мышей после
воздействия ИМПИ является увеличение продукции АФК, поскольку извест-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
120
И.Р. Князева, В.В. Иванов, Л.П. Жаркова и др.
но, что не весь кислород, потребляемый митохондриями, расходуется в процессе окислительного фосфорилирования [18, 19]. В норме 1–2% кислорода
уходит на выработку дыхательной цепью O•2 [18, 20]. Предполагают, что два
или более таких сайта находятся в комплексе Ι [21–24] и при окислении и
•
восстановлении убихинона также происходит образование O 2 [25, 26].
Снижение дыхания митохондрий может быть обусловлено тем, что высокие концентрации АФК открывают во внутренней мембране митохондрий поры неспецифической проницаемости, что приводит к удалению
адениновых нуклеотидов, снижению продукции АТФ и поглощения кислорода [27]. Кроме того, активность сукцинатдегидрогеназы и F0F1-АТФазы
ингибируется высокими концентрациями O•2 и гидроперекисями [31]. Известно, что активность систем удаления АФК (Мn-содержащая СОД и глутатионпероксидаза) в норме высока, однако при окислительном стрессе
скорость выработки АФК митохондриями может превышать скорость их
утилизации [28] и продукты окислительной модификации могут подавлять
компоненты антиоксидантной системы и привести к изменению работы
дыхательной цепи [29–31]. В пользу этого предположения может свидетельствовать ранее обнаруженное увеличение уровня продуктов липидной
пероксидации и окислительной модификации белков в печени мышей после воздействия ИПМИ [3, 8].
В ранее проведенных экспериментах с использованием флуоресцентного
зонда было показано, что ИМПИ влияет на содержание наиболее стабильной АФК – гидропероксида водорода в изолированных митохондриях печени [14]. При этом уровень гидропероксида водорода в митохондриях после
воздействия повышался и понижался в зависимости от параметров воздействия. Эффект воздействия ИПМИ на дыхание митохондрий также имеет
сложную зависимость от интенсивности и частоты повторения импульсов,
что может быть результатом разнонаправленного действия АФК на функци•
онирование дыхательной цепи. С одной стороны, O 2 образуется в процессе
переноса электронов в дыхательной цепи и синтезе АТФ, с другой стороны,
его высокий уровень в митохондриях нарушает через различные механизмы
перенос электронов и окислительное фосфорилирование.
Заключение
Таким образом, наносекундное импульсно-периодическое микроволновое излучение оказывает влияние на функциональное состояние митохондрий. Это позволяет рассматривать митохондрии как первичную мишень
воздействия микроволновых импульсов, влияние на которые может быть
причиной изменения окислительно-восстановительного статуса клеток,
тканей и органов. Помимо этого, возможно изменение продукции АТФ с
соответствующим изменением метаболизма клеток. Поскольку реакции митохондрий на воздействие ИПМИ зависят от пППМ и частоты повторения
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние импульсно-периодического микроволнового излучения
121
импульсов, реакции систем более высоких уровней организации, зависящие
от функционального состояния митохондрий, должны аналогично зависеть
от параметров облучения.
Литература
1. Большаков М.А., Коровин М.С., Гриднева В.И. и др. Оценка некоторых показателей метаболической функции печени крыс после воздействия импульсно-периодического
рентгеновского или микроволнового излучений // Экспериментальная и клиническая
гастроэнтерология. 2005. № 3. С. 70–74.
2. Коровин М.С. Изменение некоторых биохимических показателей крови белых крыс
после кратковременного воздействия импульсно-периодического микроволнового и
рентгеновского излучений // Ежегодник Российского национального комитета по защите от неионизирующих излучений / под ред. Е.П. Бичелдей. М. : АЛЛАНА, 2004.
С. 242–248.
3. Bolshakov M.A., Knyazeva I.R., Rostov V.V. et al. Initiation of free-radical oxidation in albino
mice by exposure to pulse periodic microwaves and x-rays // Biophysics. 2005. Vol. 50.
Suppl. 1. P. 104–109.
4. Литвяков Н.В., Ростов В.В., Булдаков М.А. и др. Ингибирование пролиферации опухолевых клеток импульсно-периодическим рентгеновским излучением // Сибирский
онкологический журнал. 2006. № 1 (17). С. 24–31.
5. Булдаков М.А., Литвяков Н.В., Чердынцева Н.В. и др. Импульсно-периодические СВЧ
и рентгеновское излучения: влияние на клетки костного мозга и селезенки // Вестник
Томского государственного университета. Приложение: Материалы конференции
«Механизмы индивидуальной адаптации». 2006. № 21. С. 23–24.
6. Жаркова Л.П., Афанасьев К.В., Большаков М.А. и др. Оценка влияния импульсно-периодического рентгеновского и микроволнового излучений на биологические структуры с помощью измерения импедансных характеристик // Вестник Томского государственного университета. 2008. № 312. С. 180–183.
7. Князева И.Р., Медведев М.А. Жаркова Л.П. и др. Воздействие импульсно-периодическим микроволновым и рентгеновским излучениями на эритроциты человека // Бюллетень сибирской медицины. 2009. № 1. С. 24–29.
8. Князева И.Р., Большаков М.А., Жаркова Л.П., Ростов В.В. Анализ показателей окислительной модификации липидов и белков после воздействия наносекундного импульсно-периодического микроволнового излучения // Труды 8-го Международного симпозиума по электромагнитной совместимости и электромагнитной экологии. СПб.,
2009. С. 395–398.
9. Изюмов Д.С., Домнина Л.В., Непряхина О.К. и др. Митохондрии как источники активных форм кислорода при окислительном стрессе. Исследование с помощью новых
митохондриально-направленных антиоксидантов на основе «ионов Скулачева» //
Биохимия. 2010. Т. 75. С. 149–157.
10. Euroguide on the accommodation and care of animals used for experimental and other
scientific purposes. (Based on the revised Appendix A of the European Convention ETS
123.) FELASA: Federation of European Laboratory Animal Science Associations. London,
2007. 17 с.
11. Jonson D., Lardy H. Isolation of liver or kidney mitochondria // Methods in Enzymology.
N. Y. : Acad. Press, 1969. Р. 94–96.
12. Bradford M.M. A rapid and sensitive method for the quantitation of microgram quantities
of protein utilizing the principle of protein-dye binding // Analytical Biochemistry. 1976.
Vol. 7, № 1. P. 248–254.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
122
И.Р. Князева, В.В. Иванов, Л.П. Жаркова и др.
13. Chance B., Williams G.R. Respiratory enzymes in oxidative phosphorylation. I. Kinetics of
oxygen, utilization // Journal of Biological Chemistry. 1955. Vol. 217. P. 383–393.
14. Жаркова Л.П., Мамонова Н.В., Князева И.Р. и др. Регенерация нейрогенных изъязвлений слизистой желудка после облучения импульсно-периодическим микроволновым
излучением // Вестник Томского государственного университета. Биология. 2010.
№ 2. С. 112–122.
15. Лемешко В.В., Миронова Н.Г. Обратимая криоактивация неспецифической белковой
поры как один из возможных механизмов криоразобщения и репарации системы
окислительного фосфорилирования митохондрий // Проблемы криобиологии. 1993.
№ 3. С. 14–20.
16. Szewczyk A., Wojtczak L. Mitochondria as a pharmacological target // Pharmacology review.
2002. Vol. 54. P. 101–127.
17. Short K.R., Drew B., Leeuwenburgh C. Mitochondrial ATP measurements // American Journal of Physiology. Regulatory Integrative Comp Physiology. 287. 2004. Р. 243–246.
18. Boveris А., Chance В. The mitochondrial generation of hydrogen peroxide. General properties and effect of hyperbaric oxygen // Biochemistry Journal. 1973. Vol. 134. Р. 707–716.
19. Liu S.S. Generating, Partitioning, Targeting and Functioning of Superoxide in Mitochondria
// Bioscience reports. 1997. Vol. 17. P. 259–272.
20. Turrens J.F. Superoxide Production by the Mitochondrial Respiratory Chain // Bioscience
reports. 1997. Vol. 17. Р. 3–8.
21. Гривенникова В.Г., Виноградов А.Д. Митохондриальный Комплекс I // Успехи биологической химии. 2003. Т. 43. С. 19–58.
22. Genova M.L., Ventura B., Guilano G. et al. The site of production of superoxide radical in
mitochondrial Complex I is not bound to ubisemiquinone but presumably iron-sulfur cluster // FEBS Letters. 2001. Vol. 505, № 2. Р. 364–368.
23. Kushnareva Y., Murphy A.N., Andreyev A. Complex I-mediated reactive oxygen species
generation: modulation by cytochrome c and NAD(P)+ oxidation-reduction state // Biochemistry Journal. 2002. Vol. 368. Р. 545–553. 24. Turrens J.F. Mitochondrial formation of reactive oxygen species // The Journal of
Physiology. 2003. Vol. 552. P. 335–344.
25. Nicholls D.G., Budd S.L. Mitochondria and neuronal survival // Physiol. Rev. 2000.
Vol. 80(1). Р. 15–60.
26. Grivennikova K.G., Vinogradov A.D. Generation of superoxide by the mitochondrial Complex I // Biochimica et Biophysica Acta. 2006. Vol. 1757. P. 553–561.
27. Halestrap A.P., Brenner C. The adenine nucleotide translocase: a central component of the
mitochondrial permeability transition pore and key player in cell death // Current Medicinal
Chemistry. 2003 Vol. 10(16). Р. 1507–1525.
28. Андреев А.Ю., Кушнарева Ю.Е., Старков А.А. Метаболизм активных форм кислорода
в митохондриях // Биохимия. 2005. Т. 70, вып. 2. С. 246–264.
29. Bota D.A., Davies K.J. Lon protease preferentially degrades oxidized mitochondrial aconitase by an ATP-stimulated mechanism // Nature Cell Biology. 2002. Vol. 4(9). P. 674–80.
30. Gunter T.E., Yule D.I., Gunter K.K. et al. Calcium and mitochondria // FEBS Letters. 2004.
Vol. 567. P. 96–102.
31. Zhang Y., Marcillat O., Giulivi C. et al. The oxidative inactivation of mitochondrial electron transport components and ATPase // Journal of Biological Chemistry. 1990. Vol. 265.
Р. 16330–16336.
Поступила в редакцию 15.03.2011 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Влияние импульсно-периодического микроволнового излучения
123
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 113–123
Irecle R. Knyazeva1, 3, Vladimir V. Ivanov1,
Lubov P. Zharkova2, 3, Oleg P. Kutenkov3, Vladislav V. Rostov3,
Michael A. Bolshakov2, 3
Siberian State Medical University, Tomsk, Russia
Biological Institute of Tomsk State University, Tomsk, Russia
3
Institute of High-Current Electronics of Siberian Division
of Russian Academy of Sciences, Tomsk, Russia
1
2
THE EFFECT OF THE REPETITIVE PULSED MICROWAVES
ON FUNCTIONAL ACTIVITY OF ISOLATED MITOCHONDRIA
OF MICE LIVER
The effects of pulse-periodic microwave radiation with a pulse repetition frequency in
the range of 8–22 per second and intensity of exposure from 70 to 1500 W/cm2 per pulse
on the functional activity of isolated liver mitochondria of mice were investigated. The rate
of oxygen consumption in different metabolic states of mitochondria by Chance was used
as a criterion for evaluating. The degree of conjugation of oxidation and phosphorylation
was determined by the ratio of oxygen consumption rate in the phosphorylated and
unphosphorylated states. It is shown that after irradiation changed the intensity of
respiration on exogenous substrate and with the addition of ADP in the direction of
decreasing and increasing (in most cases). The degree of conjugation of oxidation and
phosphorylation either remained unchanged or decreased after irradiation by microwave
pulses of lower intensities and the pulse repetition frequency from the used. One reason for
the increase in oxygen consumption by mitochondria in constant or reduced conjugation of
respiration and phosphorylation states could be the utilization of absorbed oxygen for the
production of reactive oxygen species by the complexes of the respiratory chain. Reduction
of mitochondrial respiration could be caused by the opening in the inner mitochondrial
membrane pores nonspecific permeability by the high concentrations of oxidants. That
event leads to metabolism of adenine nucleotides and decreasing of the ATP production
and oxygen consumption. In the case when the generation rate ROS exceed their recycling,
the products of oxidative modification can inhibit components of the antioxidant system
and lead to changes in the respiratory chain. It can be assumed the existence of the dual
action of reactive oxygen species on the functioning of the respiratory chain because the
effect of pulse-periodic microwave radiation on the functional state of mitochondria is a
•
complex dependence on the intensity and frequency of repetition. On the one hand, O 2 is
produced in the process of electron transfer in the respiratory chain and ATP synthesis, on
the other hand, its highest level in mitochondria breaks electron transport and oxidative
phosphorylation.
Key words: repetitive pulsed microwaves; mitochondria of mice liver.
Received March 15, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 124–135
УДК 574.632+597.442-11
Т.Б. Лапирова
Институт биологии внутренних вод им. И.Д. Папанина РАН
(пос. Борок, Ярославская обл.)
РЕАКЦИЯ ИММУНОФИЗИОЛОГИЧЕСКИХ ПОКАЗАТЕЛЕЙ
МОЛОДИ СИБИРСКОГО ОСЕТРА (Acipenser baerii Brandt)
НА ДЕЙСТВИЕ ПЕРМЕТРИНА
Изучено влияние пестицида перметрина на некоторые морфофизиологические и иммунологические показатели молоди сибирского осетра в хроническом
эксперименте. Показано, что даже низкие сублетальные концентрации пестицида (0,1 мкг/л) вызывают значительные колебания всех исследованных параметров. Выявленные изменения свидетельствуют о сдвигах в функционировании
печени, нарушении белкового обмена, угнетении защитных функций организма.
Ключевые слова: перметрин; молодь осетра; Acipenser baerii Brandt; иммунофизиологические показатели; хронический эксперимент.
Введение
Перметрин (пиперонилбутоксид) входит в класс пиретроидов – высокоэффективных инсектицидов с широким спектром действия, уничтожающих
как взрослых насекомых, так и их яйца и личинки. Используют перметрин
против вредителей сельскохозяйственных и декоративных культур, для
борьбы с термитами.
Помимо этого, в последние годы перметрин вытесняет традиционно применяемые для уничтожения комаров фосфорорганические соединения. Это
обусловлено, с одной стороны, его высокой эффективностью против организмов-мишеней, с другой – низкой токсичностью для млекопитающих и
птиц и относительно коротким периодом полураспада. К серьезным недостаткам этого вещества можно отнести высокую токсичность для эстуарных
рыб [1]. Значения 48-час. LC50 для рыб весьма низки и для разных видов
составляют от 0,05 до 97,0 мкг/л. Такая высокая чувствительность рыб к
препарату может быть обусловлена недостаточностью ферментной системы, гидролизующей пиретроиды, а также высокой скоростью поглощения
жабрами за счет высокой липофильности этих соединений [2]. В настоящее
время из-за широкого распространения пиретроидных препаратов их присутствие выявлено в почвенных и поверхностных водах, что делает актуальным исследование влияния этих соединений на водные организмы, в том
числе рыб. Вследствие большой важности этой проблемы она интенсивно
изучается в последнее десятилетие, однако сведения носят разрозненный
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Реакция иммунофизиологических показателей
125
характер и в основном посвящены реакции на пиретроиды отдельных показателей, механизмы же действия этой группы токсикантов до сих пор не
выяснены. Отсутствует информация о действии этих веществ на систему
неспецифической защиты организма, являющейся у рыб приоритетной.
Известно, что наиболее чувствительны к токсическим воздействиям рыбы
на ранних этапах онтогенеза, поэтому действие ксенобиотиков предпочтительнее изучать на молоди. Поскольку литературные данные по влиянию
пиретроидов на осетровых к настоящему времени отсутствуют, нами была
проведена работа по исследованию действия перметрина на молодь осетра.
Цель настоящей работы – определение реакции наиболее общих иммунофизиологических параметров молоди осетра на присутствие в воде перметрина. В задачу исследования входил анализ следующих показателей:
коэффициент упитанности; уровень общего белка и протективные свойства
сыворотки крови; индексы иммунокомпетентных органов (селезенки, сердца и печени) и содержание лизоцима в их тканях.
Материалы и методики исследования
Молодь сибирского осетра (Acipenser baerii Brandt) была получена с Волгореченского завода (Костромская область) по искусственному рыборазведению, акклимирована, к моменту начала эксперимента достигла возраста
2 мес. и имела среднюю массу 11,4±3,7 г и длину 61±11 мм. Содержали рыб
по 35 особей в проточных пластиковых лотках объемом 250 л с речной водой. Токсикант подавали в воду в форме промышленного препарата перметрина до концентрации 0,1 мкг/л действующего вещества, что составило 0,1
от установленной 96-час. LC50. Для поддержания постоянства концентрации
токсиканта у подопытных рыб применяли дилютерную установку оригинальной конструкции [3]. Полный обмен воды в лотках как контрольной,
так и подопытной групп рыб осуществлялся в течение суток. Рыб кормили
ежедневно, отбор проб проводили через 1, 2, 4 и 8 недель после помещения
рыб в раствор токсиканта. Материал получали от 5 контрольных и 5–8 подопытных рыб на точку в двух повторностях. Температура воды в период
эксперимента составляла в среднем 17оС.
Кровь получали из хвостовой вены после каудэктомии, сыворотку для
серологических исследований отбирали пастеровской пипеткой после ретракции сгустка. После измерения и взвешивания рыб отбирали органы,
взвешивали их, помещали в забуференный физраствор и замораживали до
проведения анализа.
Коэффициент упитанности по Кларк рассчитывали как отношение массы
порки к кубу длины рыбы, умноженное на 100. Индексы внутренних органов определяли в процентах от массы порки [4]. Одним из важнейших
иммунокомпетентных органов у рыб являются почки, но поскольку на начальных этапах эксперимента масса их была очень мала, для исследования
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
126
Т.Б. Лапирова
отбирали сердце, селезенку и печень, размер которых позволил провести
корректный анализ данных. Содержание общего белка сыворотки крови
определяли рефрактометрически.
Экстракты тканей органов получали по общепринятым методикам [5, 6].
Навеску исследуемого органа (не более 1 г) растирали в стеклянном гомогенизаторе, разводили 0,45%-ным физиологическим раствором c рН 6,2 в объемно-весовом отношении 1:1. После часового выдерживания при комнатной
температуре гомогенаты подвергали трехкратному замораживанию и оттаиванию для более полного экстрагирования фермента. Центрифугировали
пробы при охлаждении (+4оС) в течение 30 мин при 10 тыс. об./мин.
В надосадочной жидкости определяли содержание лизоцима высокочувствительным нефелометрическим методом [7], основанным на способности фермента растворять оболочку бактерий Mycrococcus lysodeicticus. Для
работы использовали суспензию лиофилизированных бактерий, в качестве
стандарта для построения калибровочной кривой – лизоцим яичного белка.
Концентрацию фермента рассчитывали в мкг/мг массы ткани.
Принцип метода учета бактериостатической активности сыворотки крови
(БАСК) основан на ее способности угнетать рост микроорганизмов. Мы проводили определение этого показателя нефелометрическим методом, разработанным О.В. Смирновой и Т.А. Кузьминой (1966 г.), с использованием живой
суточной культуры Aeromonas hydrophila [8]. Результаты приведены в процентах угнетения роста тест-культуры в среде, содержащей сыворотку крови по
сравнению с контролем, где в среду вместо сыворотки добавлен физраствор.
Статистическая обработка результатов проведена в программе Microsoft
Office Excel, статистическую значимость различий определяли по критерию
Стьюдента при р≤0,05. Данные представлены в виде средних значений ±
стандартное отклонение.
Результаты исследования и обсуждение
Из всех исследованных параметров только на коэффициент упитанности перметрин не оказал выраженного влияния. Значения показателя в течение эксперимента незначительно колебались: от 0,28±0,02 до 0,33±0,01 и от
0,31±0,04 до 0,33±0,02 у контрольных и подопытных рыб соответственно,
но значимых различий между этими группами не выявлено.
Все исследованные иммунофизиологические показатели претерпели значительные изменения. Иммунная система чрезвычайно чувствительна к любым как экзо-, так и эндогенным воздействиям и реагирует на них одной из
первых [9]. Поэтому логично ожидать сдвигов в функционировании важнейших иммунокомпетентных органов, в том числе и изменений их относительных масс, при токсическом воздействии. Структура и функции иммунной
системы рыб имеют некоторые особенности по сравнению с высшими позвоночными. Так, кроветворные и иммунные функции у рыб (т.е. развитие
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Реакция иммунофизиологических показателей
127
клеток, участвующих в иммунном ответе, и реализация ими своих функций)
осуществляются в одних и тех же органах. Таким образом, гематопоэтические органы рыб одновременно служат и органами иммунной системы [10].
Помимо почек у рыб к наиболее важным органам гемо- и иммунопоэза
относят селезенку. Ткань ее содержит большое количество клеток лимфомиелоидного ряда [11, 12], что обусловливает ее активное участие в реакции
на неблагоприятные воздействия. Хрящевые ганоиды, к которым относятся
осетровые, принадлежат к числу наиболее древних рыб, что объясняет некоторые отличия в организации иммунной системы этих рыб. Так, к характерным особенностям гемопоэза осетровых можно отнести наличие так называемого перикардиального органа, расположенного на вентральной стороне
сердца. В строме ткани сердца экстраваскулярно идут процессы эритропоэза, гранулоцитопоэза, лимфопоэза [13–15], что позволяет отнести сердце к
иммунокомпетентным органам. Печень у рыб, помимо детоксикационной,
осуществляет также ряд защитных функций [16]. В обеспечении выполнения печенью иммунных реакций важная роль принадлежит имеющимся в ее
ткани макрофагам – купферовым клеткам [15].
Как показали результаты нашего исследования, наибольшие колебания
относительной массы под действием перметрина выявлены в селезенке;
причем как подъем, так и снижение индексов органа были статистически
значимы (рис. 1). К концу наблюдений значения показателя практически
сравнялись с контролем. Индексы сердца, как и селезенки, достоверно снизились в первый срок отбора, далее разница между значениями контрольных и подопытных особей была статистически незначима.
Анализ полученных результатов показывает рост относительной массы печени в контрольной группе рыб на протяжении всего срока наблюдений. Это
объяснимо для активно питающейся молоди в период интенсивного роста.
При этом происходят значимое возрастание показателя у подопытных рыб относительно контроля к концу 2-й недели и резкое снижение к концу опыта.
Результаты проведенного эксперимента подтверждают активное участие
всех исследованных органов в реакции на воздействие перметрина. Динамика изменения относительных масс сердца и селезенки в целом очень
сходна (достоверное снижение показателя на первом этапе воздействия),
имеются некоторые отличия лишь в размахе колебаний. Уменьшение индексов селезенки было описано при действии токсикантов различных классов
на разные виды рыб. Так, показано, что при помещении тиляпии в раствор
фосфорорганического пестицида индексы селезенки через 30 сут и до конца
опыта (60 сут) были сильно снижены, что авторы объясняют интенсивным
выбросом клеток из депо в кровеносное русло [17]. Аналогичная реакция
выявлена и при хроническом действии поллютантов: у большинства исследованных черноморских видов рыб значения индексов селезенки у особей,
обитающих в более загрязненной части акватории, были ниже, чем из менее
загрязненной [18].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Т.Б. Лапирова
128
а
*
%
0,35
0,30
0,25
0,20
0,15
0,10
0,05
0,00
б
% 0,30
%
% 0,40
0,25
*
*
0,20
*
0,15
0,10
0,05
1
2
4
0,00
8
1
Сроки отбора, недели
Контроль
Опыт
а
2
Контроль
%
8
Опыт
б
в
% 2,5
4
Сроки отбора, недели
*
2,0
1,5
*
1,0
0,5
0,0
1
2
4
8
Сроки отбора, недели
Контроль Опыт
в
Рис. 1. Индексы внутренних органов: а – сердце; б – селезенка; в – печень.
Здесь и далее в рисунках и таблице звездочкой отмечены
статистически значимые отличия от контроля (р ≤ 0,05)
Сопоставление наших и литературных данных позволяет говорить о неспецифической реакции данного параметра на токсическое воздействие, обусловленной дополнительным выходом в кровь клеточных элементов для
минимизации негативного влияния внешних факторов. Отмеченный нами
позже (2 недели) подъем показателя вызван, видимо, усиленным кровотоком
в работающем в форсированном режиме органе. Возрастание массы селезенки некоторые другие авторы [19] также связывают с более интенсивным
кровообразованием, а следовательно, проявлением адаптации к меняющимся условиям среды. К концу наблюдений происходит возврат показателя и
по сердцу, и по селезенке на контрольный уровень.
Кривая изменений гепатосоматического индекса отличалась от описанных для сердца и селезенки. Значительных сдвигов показателя к 1-й неделе
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Реакция иммунофизиологических показателей
129
экспозиции не выявлено, но ко 2-й он достоверно превысил контрольный
уровень. Увеличение массы органа является характерным проявлением
адаптивной реакции в ответ на токсический стресс [20], косвенно может
указывать на развитие воспалительных процессов в органе на начальных
этапах воздействия. Резкое снижение индекса печени к концу эксперимента
свидетельствует о том, что фаза адаптации не наступила, ресурсы органа
истощаются. Нестабильность относительных масс печени, выявленная в
течение эксперимента, вызвана гепатотоксическим действием перметрина,
вследствие чего возникают сбои в функционировании органа.
Нарушения в работе печени наглядно подтверждают также данные по
уровню сывороточного белка, так как синтез основных плазматических белков у рыб осуществляется именно в этом органе [12]. Снижение концентрации сывороточного белка в нашем опыте отмечалось уже с первого срока
отбора (рис. 2). Помимо нарушения процессов биосинтеза белка печенью
снижение данного показателя может быть связано с усилением катаболических процессов, перераспределением белка между тканями и кровью, нарушением водно-солевого обмена.
г%
% 2,5
г
2,0
*
1,5
*
*
1,0
0,5
0,0
1
2
4
8
Сроки отбора, недели
Контроль
Опыт
Рис. 2. Концентрация общего белка сыворотки крови
Патологические изменения в структуре иммунокомпетентных органов
(почек, печени и селезенки), являющиеся выражением неспецифической
реакции тканей органов в ответ на действие разных групп пестицидов, подтверждаются гистологическими исследованиями [21].
Лизоцим является важнейшим фактором гуморального иммунитета. Он
не только непосредственно нейтрализует кокковую флору, растворяя муреиновый слой клеточной стенки, но и принимает активное участие в общей
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
130
Т.Б. Лапирова
регуляции иммунного ответа. Так, только в присутствии лизоцима иммунные комплексы способны активировать систему комплемента и подключать
ее к антимикробной защите [22]. Предполагается, что лизоцим играет роль в
поддержании гомеостаза в период адаптации к резким изменениям среды и,
таким образом, может служить ранним биомаркером, свидетельствующим о
нарушении защитных механизмов [23].
Сведений о реакции показателя в тканях органов очень мало, в основном
приводятся данные по содержанию лизоцима в сыворотке крови. Большинство авторов сообщает о снижении активности сывороточного лизоцима при
хроническом действии стрессоров самой различной природы, при этом на
начальных этапах воздействия выявляются достаточно резкие колебания показателя. Возрастание концентрации лизоцима сыворотки на 14-е сут эксперимента обнаружено при изучении влияния стресса, вызванного высокой
плотностью посадки [24]. Аналогичные изменения, причем одинаковые для
лизоцима как плазмы, так и почек, обнаружены и при действии химических
стрессоров: уровень фермента возрастал на протяжении 2 недель при помещении рыб (Paralichthys olivaceus) в раствор фенантрена [25]. Имеются
сообщения об угнетении лизоцимной активности сыворотки крови при действии разных пиретроидных пестицидов. Бета-циперметрин и цигалотрин
снижали уровень показателя, причем влияние последнего не зависело от
дозы и продолжительности воздействия [26]. Приводятся данные о снижении уровня белков плазмы и активности лизоцима после 8 недель действия
другого пиретроида – циперметрина [27].
Установлено, что основная масса фермента синтезируется тканевыми
макрофагами и молодыми нейтрофилами [28], поэтому содержание лизоцима в ткани органа определяется количеством в нем клеток миелоидного ряда. Как уже упоминалось, сердце и селезенка у осетровых являются
важными очагами кроветворения, содержание иммуноцитов в них намного
выше, чем в печени, а следовательно, выше оказалась и концентрация лизоцима.
Самый высокий уровень содержания фермента у контрольных рыб выявлен в селезенке. Изменения показателя во всех органах в течение эксперимента в этой группе рыб были незначительны, в то время как у подопытных
они были весьма выраженными (рис. 3). Максимальное превышение показателя по сравнению с контролем наблюдалось в экстрактах тканей сердца и
селезенки в первый срок отбора – около 8 и 7 раз соответственно.
Под действием перметрина происходят колебания показателя на протяжении всего эксперимента, что свидетельствует о серьезных сдвигах в
работе иммунной системы. Такие резкие подъемы концентрации лизоцима
могут привести впоследствии к истощению ресурсов гуморальной защиты.
Прогнозировать дальнейшее падение уровня фермента в тканях позволяют
также данные о нарушении процессов гемоиммунопоэза, вызванных действием перметрина [29].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
12
10
а
*
мкг/мг
мкг/мг
Реакция иммунофизиологических показателей
*
8
40
131
б
*
30
20
6
4
10
2
0
0
1
2
4
1
8
Опыт
мкг/мг
а
Контроль
8
Опыт
б
в
*
5
4
Сроки отбора, недели
Сроки отбора, недели
Контроль
2
4
*
3
2
1
0
1
2
4
8
Сроки отбора, недели
Контроль
Опыт
в
Рис. 3. Содержание лизоцима в экстрактах тканей органов,
мкг/мг массы ткани: а – сердце; б – селезенка; в – печень
БАСК достаточно полно характеризует состояние врожденного иммунитета, поскольку включает в себя информацию об активности целого комплекса гуморальных защитных факторов. Обеспечивается она ингибирующими рост микроорганизмов веществами, лизинами, бактерицидными
белками и т.п. Однако поскольку эти факторы в основном вырабатываются
лейкоцитами, протективные свойства сыворотки крови косвенно позволяют
оценить состояние и клеточного звена иммунитета. При исследовании защитных свойств сыворотки крови и экстрактов тканей разных видов рыб
была выявлена неспецифическая реакция показателя на токсиканты разных
классов, выражающаяся в резком возрастании показателя на начальных этапах воздействия. В зависимости от силы стрессора далее может происходить возврат БАСК к исходному уровню либо его снижение вплоть до полной инактивации факторов [30, 31].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Т.Б. Лапирова
132
В первые сроки эксперимента мы не смогли осуществить определение
показателя вследствие малого количества получаемой крови, проведение
анализа стало возможным только с 4-й недели. Следует сказать, что у осетровых рыб БАСК в целом намного ниже, чем, например, у карповых. Тем
не менее у рыб, находящихся в растворе пестицида, были выявлены значимые различия по сравнению с контрольными особями (таблица).
Бактериостатическая активность сыворотки крови осетра, %
Вариант
эксперимента
Опыт
Контроль
Сроки отбора проб
4 недели
15±5
7±3
8 недель
0*
9±4
Можно предполагать, что в первые недели экспозиции возрастание
БАСК было более значительным и статистически значимым, так как и через
4 недели сохранилось двукратное превышение показателя по сравнению с
контролем. Угнетение кроветворения, снижение выработки защитных агентов привело к концу эксперимента к полному подавлению антимикробных
свойств сыворотки крови. Супрессия гуморальной защиты усугубляется в
значительной степени также снижением протеосинтеза, поскольку основная
масса защитных агентов имеет белковую природу.
Как показывают результаты нашего эксперимента, не все из изученных
показателей к концу опыта вернулись к норме, что нередко выявляется в
хронических экспериментах, когда происходит адаптация к воздействующему фактору. Это свидетельствует о глубоких нарушениях гомеостатических
механизмов. Доказательством этого положения являются результаты Х. Лутницкой [32], полученные при исследовании влияния на карпов нескольких
типов пиретроидных пестицидов.
Автор сообщает, что полного восстановления функций (деградация гистологической структуры лейкоцитов и гепатоцитов, подавление фагоцитарной активности нейтрофилов, снижение концентрации сывороточного лизоцима и т.д.), нарушение которых выявлено после 2-недельной экспозиции в
токсикантах, не наступало по прошествии 4 недель после перенесения рыб
в чистую воду.
Заключение
Резюмируя вышеизложенное, следует подчеркнуть, что полученные результаты однозначно свидетельствуют о высокой токсичности перметрина
для молоди осетра даже в низких сублетальных концентрациях. Анализ
полученных в эксперименте данных свидетельствует о том, что пестицид
вызывает ряд неспецифических изменений, приводящих к нарушению гомеостаза. Обладая гепатотоксическим действием, перметрин инициирует
развитие патологических процессов в печени, что снижает эффективность
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Реакция иммунофизиологических показателей
133
антитоксической деятельности органа; следствием сбоев в функционировании печени является снижение протеосинтеза.
Действуя на иммунокомпетентные органы, пестицид вызывает стойкое
нарушение процессов кроветворения. Угнетение лейкопоэза является причиной резких колебаний и, в конечном счете, снижения выработки факторов неспецифической гуморальной защиты как в сыворотке крови, так и в
тканях иммунокомпетентных органов. Статистически значимые различия с
контролем к концу срока наблюдений по ряду показателей свидетельствуют
о серьезных сдвигах в функционировании системы неспецифической защиты рыб под влиянием перметрина.
Автор выражает благодарность сотрудникам лаборатории экспериментальной экологии Института биологии внутренних вод им. И.Д. Папанина РАН (п. Борок, Ярославская обл.), на базе которой проводился эксперимент.
Литература
1. Rebach S. Acute Toxicity of Permethrin/Piperonyl Butoxide on Hybrid Striped Bass // Bull.
Environ. Contam. Toxicol. 1999. Vol. 62. P. 448–454.
2. Başer S., Erkoç F., Selvi M., Koçak O. Investigation of acute toxicity of permethrin on guppies Poecilia reticulate // Chemosphere. 2003. Vol. 51. P. 469–474.
3. Виноградов Г.А., Тагунов В.Б. Установка для изучения влияния различных веществ на
рыб и беспозвоночных в проточных условиях // Гидробиологический журнал. 1989.
Т. 25, № 3. С. 74–77.
4. Методика морфофизиологических и биохимических исследований рыб. М. : ВНИРО,
1972. 132 c.
5. Каграманова Л.К., Ермольева З.В. Сравнительная характеристика методов определения активности лизоцима // Антибиотики. 1966. Т. 11, № 10. С. 917–919.
6. Вихман А.А., Генералова Л.П. Методические указания по количественному анализу
гуморальных факторов резистентности в органах и тканях рыб. М. : ВНИИПРХ,
1991. 68 c.
7. Практикум по иммунологии : учеб. пособие / под ред. И.А. Кондратьевой, В.Д. Самуилова. М. : МГУ, 2002. 224 с.
8. Методические указания по определению уровня естественной резистентности и оценке иммунного статуса рыб. М. : Минсельхозпрод, 1999. 24 с.
9. Кондратьева И.А., Киташова А.А. Функционирование и регуляция иммунной системы рыб // Иммунология. 2002. № 2. С. 97–101.
10. Кондратьева И.А., Киташова А.А., Ланге М.А. Современные представления об иммунной системе рыб. Ч. 1. Организация иммунной системы рыб // Вестник МГУ.
Сер. 16. Биология. 2001. № 4. С. 11–20.
11. Флоренсов В.А., Пестова И.М. Очерки эволюционной иммуноморфологии. Иркутск :
Изд-во Иркут. ун-та, 1990. 248 с.
12. Житенева Л.Д., Макаров Э.В., Рудницкая О.А. Эволюция крови. Ростов н/Д : Деловой
мир, 2001. 114 с.
13. Fange R. Lymphoid organs in sturgeons (Acipenseridae) // Vet. Immunol. And Immunopathol. 1986. Vol. 12, № 4. P. 153–161.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
134
Т.Б. Лапирова
14. Tavassoli M. Bone marrow in boneless fish: lessons of evolution // Med. Hipotheses. 1986.
Vol. 20, № 1. P. 9–15.
15. Иванова Н.Т. Система крови. Материалы к сравнительной морфологии системы крови человека и животных. Ростов н/Д : Изд-во РГПИ, 1995. 155 c.
16. Арцимович Н.Г., Настоящая Н.Н., Казанский Д.Б., Ломакин Н.С. Печень как орган
иммунобиологической системы гомеостаза // Успехи современной биологии. 1992.
Т. 112, № 1. С. 88–99.
17. Балабанова Л.В., Степанова В.М. Хроническое действие нафталина и дихлофоса на
иммунокомпетентные клетки мозамбикской тиляпии (Oreochromis mossambicus Peters) // Биология внутренних вод. 2000. № 4. С. 146–155.
18. Кузьминова Н.С. Видовые, сезонные, половые отличия индекса селезенки некоторых
видов черноморских рыб и его подверженность антропогенному фактору // Вестник
зоологии. 2008. Т. 42, № 2. С. 135–142.
19. Кузьминова Н.С., Салехова Л.П. Индексы печени и селезенки как биоиндикаторы состояния черноморских рыб // Современные проблемы физиологии и биохимии водных организмов : сб. материалов конф. Петрозаводск, 2007. С. 81–82.
20. Goede R.W., Barton B.A. Organismic Indices and Autopsy-Based Assessment as Indicators
of Health and Condition of Fish // Amer. Fish. Soc. Symp. 1990. Vol. 8. P. 93–108.
21. Заботкина Е.А., Лапирова Т.Б. Влияние пестицидов на иммунофизиологический статус рыб (обзор) // Успехи современной биологии. 2004. № 4. С. 361–368.
22. Маянский Д.Н. Проблема иммунитета в общей патологии // Методологические аспекты современной иммунологии : сб. науч. трудов. Новосибирск : Наука, 1991. С. 74–84.
23. Weeks B.A., Anderson D.P., DuFour A.P. Immunological Biomarkers to Assess Environmental Stress // Biomarkers. Biochemical, Physiological and Hystological Markers of Anthropogenic Stress. Keystoun, 1989. 384 р.
24. Wang Wen-bo, Li Ai-hua, Wang Jian-guo, Cai Tao-zhen, Wu Yu-shen. Влияние стресса от
чрезмерной плотности посадки на неспецифические иммунные функции у Ctenopharyngodon idellus // J. Fish. China. 2004. Vol. 28, № 2. P. 139–144.
25. Jee Jung-Hoon, Kim Seong-Gil, Kang Ju-Chan. Effects of phenanthrene on growth and
basic physiological functions of the olive flounder, Paralichthys olivaceus // J. Exp. Mar.
Biol. and Ecol. 2004. Vol. 304, № 1. P. 123–136.
26. Jin Xiao-min, Wu Yin, Lu Gang, Gui Yuan-ming, Liu Yan-fang. Влияние двух пиретроидных пестицидов на лизоцим и глутамат-пируват-трансаминазу сыворотки у Cyprinus
carpio // Fish. Sci. 2006. Vol. 25, № 8. P. 383–386.
27. Jee J., Masroor F., Kang J. Responses of cypermethrin-induced stress in haematological
parameters of Korean rockfish, Sebastes schlegeli (Hilgendorf) // Aquacult. Res. 2005.
Vol. 36, № 9. P. 898–905.
28. Бухарин О.В., Васильев Н.В. Лизоцим и его роль в биологии и медицине. Томск : Издво Том. ун-та, 1974. 207 с.
29. Лапирова Т.Б. Влияние перметрина на лейкоцитарную формулу молоди осетра // Токсикологический вестник. 2009. № 6. С. 21–25.
30. Лапирова Т.Б., Микряков В.Р. Влияние некоторых стресс-факторов на функциональное состояние гуморального звена неспецифического иммунитета молоди карпа //
Вопросы рыболовства. 2005. Т. 6, № 4 (24). С. 771–780.
31. Лапирова Т.Б., Изюмов Ю.Г., Микряков В.Р. Влияние ионов кадмия на антибактериальные
свойства тканей личинок плотвы (Rutilus rutilus L.) // Проблемы охраны здоровья рыб в
аквакультуре : сб. материалов науч.-практ. конф. М. : Россельхозакадемия, 2000. С. 80–81.
32. Lutnicka H. The influence of type I and type II pyrethroids on fish organism // Toxicol. Lett.
2002. Vol. 135, suppl. 1. P. 159.
Поступила в редакцию 05.05.2011 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Реакция иммунофизиологических показателей
135
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 124–135
Tatiana B. Lapirova
I.D. Papanin Institute of Biology of Inland Water of Russian Academy of Sciences (IBIW RAS),
Borok, Nekouz region, Yaroslavl district, Russia
REACTION OF SIBERIAN STURGE FINGERLING
(Acipenser baerii Brandt) IMMUNOPHISIOLOGICAL
INDICATORS TO THE PERMETHRIN ACTION
The paper studies the influence of the pesticide permethrin (concentration 0,1 μg/L,
which accounted for 0.1 of the established 96-hour. LC50) on some morphophysiological
and immunological parameters of Siberian sturgeon fingerling in a chronic experiment.
The results of the experiment revealed active participation of all investigated
immunocompetent organs (heart, spleen, liver) in response to the toxic effects.
Fluctuations in the relative masses found for all organs, the most obvious changes were
observed in the values of hepatosomatic index, which were significantly lower than the
controls at the end of the observation period (8 weeks).
A hepatotoxic effect of the pesticide is also confirmed by the decrease in the level of
total serum protein, detected in the experimental fish. Proteinsynthesis oppression, in
turn, is one of the reasons for humoral protection suppression. Another important reason
for reducing the production of innate immunity humoral factors may be a malfunction
of leukopoiesis processes, caused by the toxic effect of pesticide on immunocompetent
organs. The combination of these effects could lead to a decrease in protective properties
of serum. This statement is confirmed by our data on the complete suppression of blood
serum bacteriostatic properties at the end of the observation period.
Besides the shifts in relative mass of immunocompetent organs, in their tissues there
were noticed fluctuations in the concentration of lysozyme. Maximum excess against
control values was revealed during the first sampling period in the extracts from tissues
of heart and spleen, which had the largest concentrations of lymphomyeloid tissue –
about 8 and 7 times respectively. Such a sharp rise in the concentration of lysozyme can
lead subsequently to the depletion of resources of the humoral protection and persistent
reduction in the level of enzyme in tissues.
Generally, the observed changes are characteristic of nonspecific stress response
case. It is noteworthy that by the end of the experiment not all of the tested parameters
had recovered to control values (as this happens during the adaptation phase), which is
indicative of intense violation of homeostatic mechanisms. The obtained data supports
the conclusion of high toxicity of permethrin for the fingerling sturgeon, even when
exposed to low sublethal concentrations.
Key words: permethrin; siberian sturgeon fingerling; Acipenser baerii Brandt;
immunological indicators; chronic experiment.
Received May 05, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 136–145
УДК 577.34 : 575.852 : 57.082.14
К.Е. Медведев1, Д.А. Афонников1,2, Ю.Н. Воробьев2,3
Институт цитологии и генетики СО РАН (г. Новосибирск)
Новосибирский государственный университет (г. Новосибирск)
3
Институт химической биологии и фундаментальной медицины СО РАН
(г. Новосибирск)
1
2
Работа выполнена при поддержке интеграционных проектов СО РАН №109,
26, 119, НОЦ НГУ (REC-008), Министерства образования и науки РФ
(ГК № П857 и 07.514.11.4003) и программ РАН А.II.6 «Молекулярная
и клеточная биология», 24 «Происхождение и эволюция биосферы»
и РФФИ (грант № 11-04-01771-а).
ИЗУЧЕНИЕ МЕТОДАМИ МОЛЕКУЛЯРНОЙ ДИНАМИКИ
СТРУКТУР БЕЛКОВ Nip7 ГЛУБОКОВОДНЫХ И МЕЛКОВОДНЫХ
АРХЕЙ В УСЛОВИЯХ ПОВЫШЕННОГО ДАВЛЕНИЯ
Исследовано влияние высокого давления на структурные характеристики РНК-связывающего белка Nip7 глубоководных и мелководных архей рода
Pyrococcus методами моделирования молекулярной динамики и компьютерного
анализа. Исследована доступность остатков растворителю и значение среднеквадратичного отклонения С-α атомов (RMSD) при разных значениях давления.
Полученные данные свидетельствуют о том, что РНК-связывающий домен
белка Nip7 более устойчив к влияниям высокого давления у глубоководного вида.
Кроме того, анализ компьютерных моделей белков Nip7 из P. abyssi и P. furiosus
показал, что с увеличением давления площадь поверхности белка, доступной растворителю, уменьшается. Для моделей Nip7 P. abyssi эта площадь меньше и ее
относительные изменения меньше, чем у Nip7 из P. furiosus.
Ключевые слова: структура белка; молекулярная динамика; высокое давление; пьезофилы; Pyrococcus.
Введение
Давление – один из важных факторов внешней среды. Большинство живых организмов обитает при атмосферном давлении ~0,1 МПа, а воздействие на них повышенного давления нарушает работу таких систем, как
репликация, транскрипция, трансляция и синтез белка, транспорт веществ
через мембраны, и приводит к гибели клеток [1]. Однако существуют организмы-пьезофилы, которые способны жить при давлениях в тысячу раз
больших атмосферного, например на дне Марианской впадины (~100 МПа).
Изучение механизмов адаптации этих организмов к высоким давлениям позволит выявить факторы, обеспечивающие устойчивость живых систем в
экстремальных условиях, а их белки могут быть использованы в биотехнологии [2].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Изучение методами молекулярной динамики структур
137
На молекулярном уровне одним из факторов нарушения работы клетки
при воздействии высоких давлений является дестабилизация белков, которые выполняют важнейшие функции. Эксперименты показали, что высокие
давления могут нарушать структуру белков и их комплексов. При увеличении давления до 200 МПа происходит распад белковых комплексов. При
давлении 500 МПа может наблюдаться частичная денатурация белка, и при
1 ГПа он полностью денатурирует [3]. Предполагают, что ключевым фактором такой дестабилизации является проникновение молекул растворителя
внутрь гидрофобного ядра белка [1].
Изучение механизмов устойчивости белков при повышенных давлениях
представляет большой интерес. В последнее время при решении этих задач
все больше используется компьютерное моделирование динамики белка.
Это направление исследований становится все более актуальным, так как
молекулярная динамика позволяет проникнуть в суть процессов, происходящих в растворе с биомолекулами, получать распределения термических
свойств молекул, анализировать ансамбли конформаций белка.
Так, в работе [4] проводилось моделирование молекулярной динамики
репрессора Arc при температуре 300 К, на протяжении 500 пикосекунд, в
диапазоне давлений от 0,1 до 100 МПа. Результаты показали, что значение
среднеквадратичного отклонения RMSD при температуре 300 К и атмосферном давлении оставалось на уровне 0,2 нм на протяжении всего моделирования. При температуре 400 К белок терял свою структуру и наблюдалась денатурация. Увеличение давления до 1 000 МПа при нормальной температуре
не давало никаких особых изменений в структуре репрессора, при 400 К и
1000 МПа не наблюдалась денатурация белка, однако присутствовало увеличение значений RMSD. В работе [5] методом молекулярной динамики исследовалось влияние высокого давления на равновесие между двумя формами белковых структур – миоглобина и нейроглобина. Результаты показали,
что основной эффект влияния давления – это снижение подвижности белка
без значительных структурных изменений.
В настоящей работе было проведено исследование структур белков Nip7
архей рода Pyrococcus из мелководных термальных источников (P. furiosus
[6], глубины обитаний до 100 м) и глубоководных, пьезофилов (P. abyssi [7],
глубины обитания около 2 200 м). Белок Nip7 вовлечен в биогенез рибосом
и участвует в процессинге 27S пре-рРНК и в образовании 60S субъединицы
рибосом [8]. Атомная модель данного белка содержит два независимых мономера и 252 молекулы воды. Мономеры не содержат структурных различий
и формируют димер, который, по мнению авторов, образовался в результате
кристаллизации и не имеет биологической значимости. Мономер Nip7 состоит из двух альфа-бета доменов (рис. 1). N-терминальный домен состоит из пяти антипараллельных β-листов, окруженных тремя α-спиралями и
одной спиралью 310. РНК-связывающий С-терминальный домен включает аминокислотные остатки с 95-го по 159-й и состоит из β-листов, одной
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
138
К.Е. Медведев, Д.А. Афонников, Ю.Н. Воробьев
α-спирали и одной короткой спирали 310 [9]. Аминокислоты аргинин и лизин
R151, R152, K155, K158 С-терминального домена формируют положительно заряженную область, которая способствует связыванию белка и РНК.
Мы сравнили динамику белков Nip7 из двух организмов при различных
давлениях между собой, чтобы выявить возможные отличия структурных
свойств этих белков. В результате было показано, что деформация структуры Nip7домена
мелководной
археи P.положительно
furiosus в целом
больше, чемобласть,
у глубоководной
С-терминального
формируют
заряженную
которая способствуе
P. abyssi.
Структурные
деформации
РНК-связывающего
сайта
при высоких
ыванию белка и РНК.
большеNip7
у белка
из P.
furiosus. Анализ
компьютерных
моделей
Мы сравнили давлениях
динамику белков
из двух
организмов
при различных
давлениях
между собой, чтобы
белков
Nip7
из
P.
abyssi
и
P.
furiosus
показал,
что
с
увеличением
давления
ить возможные отличия структурных свойств этих белков. В результате было показано, что деформаци
площадь поверхности
белка,в доступной
растворителю,
уменьшается.
Для Структурны
ктуры Nip7 мелководной
археи P. furiosus
целом больше,
чем у глубоководной
P. abyssi.
рмации РНК-связывающего
высоких меньше
давлениях
у белка изменения
из P. furiosus. Анали
моделей Nip7 P.сайта
abyssi при
эта площадь
и еебольше
относительные
ьютерных моделей
белков
и P.
furiosus показал,
что с согласуются
увеличением сдавления
площад
меньше,
чем уNip7
Nip7изизP.P. abyssi
furiosus.
Полученные
результаты
гирхности белка,потезой
доступной
растворителю
уменьшается.
Для
моделей
Nip7
P.
abyssi
эта
площадь
меньше
ие
о важности взаимодействия белка с растворителем при увеличении
сительные изменения
меньше,
чем
у
Nip7
из
P.
furiosus.
Полученные
результаты
согласуются
с
гипотезой
давления.
ости взаимодействия белка с растворителем при увеличении давления.
N-терминальный домен
С-терминальный домен
нок 1. Трёхмерная структура белка Nip7 P. furiosus. Белым цветом выделены остатки, которые отличаются
Рис. 1.Овалами
Трехмерная
структура
белка Nip7
P. furiosus.
Серым цветом
елков P. abyssi и P. furiosus.
выделены
домены
белка:
слева N-терминальный
домен, справа – Свыделены
остатки,
которые
отличаются
у
белков
P. abyssi
минальный, РНК-связывающий домен. Изображение структуры получено
с помощью программы Accelrys
и P. furiosus, черным – идентичные остатки. Пунктиром выделены
Discovery Studio Visualizer [10]
домены белка. Изображение структуры получено с помощью программы
Accelrys Discovery Studio Visualizer [10]
Материалы и методики исследования
Структуры белков Nip7 P. abyssi и P. furiosus.
Материалыпричинам.
и методики
исследования
Белки Nip7 были выбраны по следующим
Во-первых,
для них был идентифицирован режим
ущего отбора в ходе эволюции архей Pyrococcus [11]. Следовательно, функция этого белка может быт
ой для адаптацииСтруктуры
организмовбелков
к изменению
давления
Во-вторых,
гомолога
Nip7 P.
abyssi исреды.
P. furiosus.
Белкидля
Nip7
были P.
вы-abyssi известн
транственная браны
структура
[9]. В-третьих,
длина
его полипептидной
невелика, составляет 16
по следующим
причинам.
Во-первых,
для них был цепи
идентифицирован
окислотных остатков,
что приемлемо
длявмоделирования.
последовательности
режим движущего
отбора
ходе эволюции В-четвертых,
архей Pyrococcus
[11]. Следова- Nip7 P. abyss
о гомолога утельно,
P. furiosus
выравниваются
без
делеций/вставок,
уровень
сходства
последовательносте
функция этого белка может быть важной для адаптации организмов
авляет около к75%,
что
позволяет
моделировать
пространственную
структуру
гомолога
у P. furiosus бе
изменению давления среды. Во-вторых, для гомолога P. abyssi известна
нструкции петель (этапа предсказания структуры белка по гомологии, который вносит существенны
бки).
Трёхмерная структура белка Nip7 P. abyssi была взята из банка данных PDB [12], идентификационны
р 2P38. Структура белка Nip7 P. furiosus отсутствует в банке данных PDB, поэтому генерация её модел
зводилась с помощью программы SWISS-MODEL [13]. Данная программа осуществляет построени
ли белка по гомологии с известной структурой. На вход подавалось выравнивание аминокислотны
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Рисунок
1. Трёхмерная
белка
Nip7 P.структур
furiosus. Белым цветом выделены ос
Изучение
методами структура
молекулярной
динамики
у белков P. abyssi и P. furiosus. Овалами выделены домены белка:139
слева N-термина
терминальный, РНК-связывающий домен. Изображение структуры получено с пом
Discovery Studio Visualizer [10]
пространственная структура [9]. В-третьих, длина его полипептидной цепи
невелика, составляет 166 аминокислотных
остатков, ичто
приемлемо
для
Материалы
методики
исследования
моделирования.
В-четвертых,
последовательности
Nip7
P.
abyssi
и
его
гоСтруктуры белков Nip7 P. abyssi и P. furiosus.
молога у P. furiosus
выравниваются
без по
делеций / вставок,
уровеньВо-первых,
сходства для них бы
Белки Nip7
были выбраны
следующим причинам.
последовательностей
составляет
75%,архей
что Pyrococcus
позволяет моделировать
движущего отбора
в ходе около
эволюции
[11]. Следовательно, функц
важной для структуру
адаптации гомолога
организмов
изменению
среды. пеВо-вторых, для
пространственную
у P.к furiosus
без давления
реконструкции
пространственная
структура белка
[9]. В-третьих,
длинакоторый
его полипептидной
цепи
тель (этапа
предсказания структуры
по гомологии,
вносит
аминокислотных
существенные
ошибки). остатков, что приемлемо для моделирования. В-четвертых, послед
и его гомолога
P. furiosus
без из
делеций/вставок,
Трехмерная
структурау белка
Nip7 P.выравниваются
abyssi была взята
банка данных уровень схо
составляет около 75%, что позволяет моделировать пространственную структуру
PDB [12], идентификационный номер 2P38. Структура белка Nip7 P. furiosus
реконструкции петель (этапа предсказания структуры белка по гомологии, кото
отсутствует
в банке данных PDB, поэтому генерация ее модели производиошибки).
лась с помощью
программы
SWISS-MODEL
Данная
осу- данных PDB
Трёхмерная
структура
белка Nip7 [13].
P. abyssi
былапрограмма
взята из банка
ществляет
построение
модели
белка
по
гомологии
с
известной
структурой.
номер 2P38. Структура белка Nip7 P. furiosus отсутствует в банке данных PDB, по
На входпроизводилась
подавалось выравнивание
аминокислотных
последовательностей
с помощью программы
SWISS-MODEL
[13]. Данная программа
двух рассматриваемых
белков
без делеций
и вставок
(рис. 2). На вход подавалось выра
модели белка по
гомологии
с известной
структурой.
последовательностей двух рассматриваемых белков без делеций и вставок (Рис. 2).
1········10········20········30········40········50········60
P.A: MSGELRVRRASSWELDLILKEAEKYGELLHEFFCVVEGKYRDVYAVNEEVWKIIEDINMR
P.F: MNGEIIARRASSWEIDLILKEAEKFGTLVHNFFAIVEGKYRDVYAVNNEVWKIIEDLTVR
····ВВВ···АААААААААААА··ВВВ····ВВВВВ···ВВВВВВ·АААААА·······
·········70········80········90········100·······110·······120
P.A: PYSLGTFVGTIRVDENLVEKFYPNLEFFSLIKLEKNYVILGPKASFLFTTGKDAPKEAVR
P.F: PFALGTFVGMIKVDENLVEKFYPAIEFFTFVDIEKNYAVLGPKASFLFTTGKDVPKKAVR
····ВВВВВВВВВ·····ВВВВВ·АААА··ВВВ···ВВВВ·АААААААА·········ВВ
·········130·······140·······150·······160···166
P.A: EIKWQGSKRVVVLNDLGDIIGIGLINPKSDRRFIKNLKDVGEFLRR
P.F: KLVWKGSKKIVVMNELGDVLGIGRINPSNEEKFIKNITDVGAFLRK
ВВВ·····ВВВВВ·····ВВВВВВВ········ВВВВВ········
Рисунок 2. Сравнение последовательностей Nip7 из P. abyssi (P.A. – верхняя строка
Рис. 2. Сравнение последовательностей Nip7 из P. abyssi (P.A – верхняя строка
(P.F
– вторая строка
выравнивания).
выравниванием
выравнивания)
и P. furiosus
(P.F – втораяНад
строка
выравнивания).последовательностей при
белка.
Под
выравниванием
приведен
тип
вторичной
структуры
аминокислотного о
Над выравниванием последовательностей приведена нумерация позиций
белка.
DSSP (Атип
- α-спирали,
– β-нити,аминокислотного
пробел – прочие типы вторичной
Под выравниванием приведен
вторичной В
структуры
остатка согласно разметке DSSP (А – α-спирали, В – β-нити,
пробел – прочие типы вторичной структуры)
Моделирование молекулярной динамики
2
Для создания модели белка в окружении молекул раствора использовалась программа WHAT IF [14]. Модель включает 1 568 атомов белка и
50 000 молекул воды.
Моделирование молекулярной динамики пространственной структуры
белка осуществлялось с помощью пакета программ GROMACS [15] с использованием молекулярного силового поля GROMOS 45А3. Мы моделировали белок при температуре 300 К в кубической ячейке с ребром 6 нм, окруженный молекулами воды и ионами для компенсации заряда, при давлениях
0,1 10, 100, 150 и 200 МПа. Параметры моделирования были установлены,
как рекомендовано в работе Коллинза и соавт. [16]. Время моделирования
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
140
К.Е. Медведев, Д.А. Афонников, Ю.Н. Воробьев
равнялось 300 пикосекундам. Это время соответствует небольшим флуктуациям в структуре белка и является достаточным для того, чтобы программа
привела белок в состояние равновесия.
Для анализа брались структуры после достижения равновесия в процессе моделирования в системе «белок – растворитель». Равновесие достигалось начиная с 250 пс. Таким образом, в рассмотрение брались структуры с
момента моделирования 250 до 300 пс через каждые 5 пс, всего 11 структур.
Для сравнения бралась исходная модель в начальный момент времени (0 пс).
Анализ результатов моделирования
Вторичная структура рассчитывалась программой DSSP [17].
Отклонение структур характеризовали среднеквадратичным отклонением координат C-альфа атомов (RMSD). Эта величина измеряется в ангстремах (1Å = 10–10м) и вычисляется по следующей формуле:
=
v, w)
RMSD(
1 n
2
2
2
 n ∑ (vix − wix ) + (viy − wiy ) + (viz − wiz ) 
 i =1

где v, w – структуры белка; i – номер остатка; j – координаты С-альфа атома
(j = x, y, z); vij, wij – значения координаты j С-альфа атома остатка i структуры
v; n – общее количество остатков. Для полностью совпадающих структур
RMSD равно 0; чем больше ее значения – тем выше различия в структурах белков. Все структурные характеристики моделей, такие как значение
RMSD и поверхность, доступная растворителю, рассчитывались программами из пакета GROMACS.
Для того чтобы определить, какие участки структуры белка подвержены
наибольшим изменениям в результате воздействия давления, мы рассчитывали для каждого остатка m локальное отклонение структуры полипептидной цепи RMSDqm:
RMSD
=
q (v, w)
 i<n+ q

2
1
2
2
2
(vix − wix ) + (viy − wiy ) + (viz − wiz ) 

 q i= n − q

2


∑
RMSDqm по смыслу аналогичен RMSD, но оценивается в пределах скользящего окна размером q = 10 аминокислот. Величины vij, wij определены выше,
m – индекс положения окна в последовательности (q / 2 < m < = n–q / 2).
Результаты исследования и обсуждение
На рис. 3 приведены значения RMSD между исходной моделью белка Nip7 P. furiosus и моделями на разных шагах моделирования. Из рис. 3
видно, что после шага моделирования, соответствующего времени 250 пс,
RMSD выходит на плато 2–3 Å и в дальнейшем не возрастает. Это означает,
что модель белка достигает состояния равновесия, является стабильной и
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Изучение методами молекулярной динамики структур
141
не подвергается разворачиванию полипептидной цепи при времени моделирования до 300 пс. Аналогичную стабилизацию значений RMSD мы наблюдали и для всех остальных моделей при исследованных нами давлениях.
Таким образом, все полученные нами модели были стабильными на интервалах до 300 пс.
Среднеквадратичное отклонение
RMSD (A)
3,5
3
2,5
2
1,5
0,1МПа
10МПа
1
150МПа
200МПа
0,5
0
0
25
50
75
100 125 150 175 200 225
Время
пикосекунды
Время моделирования,
моделирования, пс
250
275
300
300
Рис. 3. Зависимость среднеквадратичного отклонения RMSD от времени
моделирования для белка Nip7 P. furiosus при различных значениях давления
Для того чтобы исследовать, какие участки белка подвергаются структурным изменениям при воздействии давлений, мы сравнили профиль локальных изменений структуры белка RMSDq для белков Nip7 P. furiosus
и P. abyssi при различных давлениях. Пример профиля при давлении 150
МПа приведен на рис. 4. Интересно отметить, что для некоторых участков
белка и в одном и в другом белке наблюдается сильное отклонение от исходной структуры (позиции 59–77). В то же время для профиля отклонений есть и отличия. В целом отклонения структуры для белка P. furiosus
больше, чем для P. abyssi. Интересно, что отличия RMSDq наблюдаются и
для участка связывания РНК: отклонения от исходной структуры меньше в
этих районах для белка P. abyssi, что может свидетельствовать о большей
стабильности РНК связывающего домена этого белка (рис. 4).
Известно, что одним из основных факторов дестабилизации белковой
структуры при действии высокого давления является взаимодействие с
растворителем. Для того чтобы проанализировать, как меняется взаимодействие с растворителем при воздействии на структуру белка высокого
давления, мы рассчитали для разных давлений среднюю площадь остатков,
доступных растворителю для моделей белков Nip7 P. abyssi и P. furiosus и
разных давлений. Результаты представлены на рис. 5.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
К.Е. Медведев, Д.А. Афонников, Ю.Н. Воробьев
142
Рис. 4. Зависимость среднеквадратичного отклонения RMSDq от номера
аминокислотного остатка для двух исследуемых белков при давлении 150 МПа.
Стрелками отмечены участки связывания РНК [9], которые являются достаточно
консервативными, и с увеличением давления значение их RMSDq практически
не изменяется. Прямоугольником отмечена область наибольшего изменения
значения RMSDq для обоих белков
104
102
P. furiosus
P. abyssi
2
нмнм2/остаток
/остаток
100
98
96
94
92
90
88
86
84
0,1
10
100
150
200
Давление, МПа
Рис. 5. График зависимости средней доступности остатка растворителю
от давления для двух исследуемых белков
Из рис. 5 видно, что для белка Nip7 P. furiosus, который обитает на мелководье, средняя доступность остатка растворителю выше, чем у P. abyssi.
Кроме того, наибольшее изменение средней доступности остатка растворителю происходит при переходе от 0,1 к 100 МПа, что соответствует природным давлениям: 0,1 МПа – атмосферное давление, 100 МПа – давление на
дне Марианской впадины. Это означает, что наиболее сильные изменения
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Изучение методами молекулярной динамики структур
143
площади поверхности этих белков происходят в интервалах давлений, характерных для глубин Мирового океана.
Из рис. 6 видно, что доступность гидрофильных остатков растворителю
практически остается неизменной. Поэтому основной вклад в изменение
доступности остатков растворителю вносят гидрофобные аминокислоты
белковой структуры.
Доступность гидрофобных остатков растворителю
64
62
P. furiosus
P. abyssi
2
нм
/остаток
нм2/остаток
60
58
56
54
52
50
48
46
0,1
45
10
100
Давление, МПа
150
200
а остатков растворителю
Доступность гидрофильных
40
2
нмнм2/остаток
/остаток
35
30
25
P. furiosus
P. abyssi
20
15
10
5
0
0,1
10
100
Давление, МПа
150
200
б
Рис. 6. Изменение средней доступности остатков растворителю в зависимости
от давления для гидрофильной (б) и гидрофобной (а) составляющих поверхности
Полученные результаты согласуются с гипотезой о важном вкладе взаимодействия белка с растворителем при воздействии повышенных давлений.
Заключение
В работе проведено сравнение компьютерных моделей трехмерных
структур белков Nip7 из P. abyssi и P. furiosus при давлениях от 0,1 до
200 МПа. Показано, что деформация структуры Nip7 мелководной P. furiosus в целом больше, чем глубоководной P. abyssi. Структурные деформации
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
144
К.Е. Медведев, Д.А. Афонников, Ю.Н. Воробьев
РНК-связывающего сайта при высоких давлениях больше у белка из P. furiosus.
Кроме того, анализ компьютерных моделей белков Nip7 из P. abyssi и P. furiosus
показал, что с увеличением давления площадь поверхности белка, доступной
растворителю, уменьшается. Для моделей Nip7 P. abyssi эта площадь меньше
и ее относительные изменения меньше, чем у Nip7 из P. furiosus. Полученные
результаты согласуются с гипотезой о важности взаимодействия белка с растворителем при увеличении гидростатического давления.
Литература
1. Winter R., Oger P. Origins of life and biochemistry under high-pressure conditions // Chemical Society Reviews. 2006. № 35. P. 858–875.
2. Bull A.T., Ward A.C., Goodfellow M. Search and Discovery Strategies for Biotechnology: the
Paradigm Shift // Microbiol. Mol. Biol. Rev. 2000. № 64. Р. 574–606.
3. Doster W., Petry W., Schober H. High pressure – unfolding of myoglobin studied by dynamic
neutron scattering // Chemical Physics. 2003. Р. 383–387.
4. Trzesniak D., Lins R.D., van Gunsteren W.F. Protein under pressure: molecular dynamics
simulation of the arc repressor // Proteins. 2006. № 65. Р. 136–144.
5. Capece L., Marti M.A., Bidon-Chanal A. et al. High pressure reveals structural determinants for
globin hexacoordination: Neuroglobin and myoglobin cases // Proteins. 2009. № 75. Р. 885–894.
6. Fiala G., Stetter K.O. Pyrococcus furiosus sp. nov. represents a novel genus of marine heterotrophic archaebacteria growing optimally at 100°C // Arch Microbiol. 1986. № 145. Р. 56–61.
7. Erauso G., Reysenbach A-L., Godfroy A., Meunier J-R. et al. Pyrococcus abyssi sp. nov., a
new hyperthermophilic archaeon isolated from a deep-sea hydrothermal vent // Arch Microbiol. 1993. № 160. P. 338–349.
8. Bassler J., Grandi P., Gadal O. et al. Identification of a 60S preribosomal particle that is
closely linked to nuclear export // Mol. Cell. 2001. № 8. Р. 517–529.
9. Coltri P., Guimaraes B., Garanto D., Luz J. Structural Insights into the Interaction of the
Nip7 PUA Domain with Polyuridine RNA // Biochemistry. 2007. № 46. Р. 14177–14187.
10. Sali A., Pottertone L., Yuan F. et al. Evaluation of comparative protein modeling by MODELLER // Proteins. 1995. № 23. P. 318–326.
11. Gunbin K.V., Afonnikov D.A., Kolchanov N.A. Molecular evolution of the hyperthermophilic archaea of the Pyrococcus genus: analysis of adaptation to different environmental
conditions // BMC Genomics. 2009. № 10. Р. 639.
12. Berman H.M., Westbrook J., Feng Z., Gilliland G. et al. The Protein Data Bank // Nucleic
Acids Research. 2000. № 28. Р. 235–242.
13. Schwede T., Kopp J., Guex N., Peitsch M.C. SWISS-MODEL: An automated protein homology-modeling server // Nucl. Acids Res. 2003. № 31. Р. 3381–3385.
14. Vriend G. WHAT IF: A molecular modeling and drug design program // J. Mol. Graph.
1990. № 8. P. 52–56.
15. Van der Spoel D., Lindahl E., Hess B. et al. GROMACS: Fast, Flexible and Free // J. Comp.
Chem. 2005. № 26. Р. 1701–1718.
16. Collins M.D., Hummer G., Quillin M.L., Matthews B.W. and Gruner S.M. Cooperative
water filling of a nonpolar protein cavity observed by high-pressure crystallography and
simulation // Proc. Natl. Acad. Sci. USA. 2005. № 102. Р. 16668–16671.
17. Kabsch W., Sander C. Dictionary of protein secondary structure: pattern recognition of
hydrogen-bonded and geometrical features // Biopolymers. 1983. № 22. Р. 2577–2637.
Поступила в редакцию 04.05.2011 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Изучение методами молекулярной динамики структур
145
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 136–145
Kirill E. Medvedev, Dmitry A. Afonnikov, Yury N. Vorobjev
Institute of Cytology and Genetics of Siberian Branch
of Russian Academy of Sciences, Novosibirsk, Russia
MOLECULAR DYNAMICS STUDY OF HIGH PRESSURE
INFLUENCE ON THE STRUCTURE OF Nip7 PROTEIN FROM
DEEP-SEA AND SHALLOW-WATER ARCHAEA
Pressure is an important environmental factor for living organisms. Most of them live at
atmospheric pressure of 0,1 MPa. At high pressure the functioning of a number of important
cellular systems such as replication, transcription, translation and protein synthesis and
transport of substances through the membrane is disrupted. This results in cell malfunction
and death. However, there exist organisms, piezophiles, which are able to live and proliferate
at pressures about one thousand times more than atmospheric, for example, at the bottom of
the Mariana Trench (~ 100 MPa). The study of adaptation mechanisms of these organisms to
high pressure environment will allow to identify the factors that provide resistance of living
systems to extreme conditions. Their proteins can be used in biotechnology.
One of the damaging factors at high pressures is the destabilization of proteins
performing important functions. It was experimentally shown that high pressure destabilizes
the structure of proteins and their complexes. Protein complexes tend to dissociate at
pressures of about 200 MPa. The pressure of 500 MPa induce partial denaturation of
proteins. The pressure of 1 GPa result in complete unfolding of protein chain. It is believed
that the main factor of such instability is the penetration of solvent molecules into the
hydrophobic core of the protein. Studies of the mechanisms of protein stability at high
pressures are of great importance. Recently, computer simulations of protein dynamics
were implemented to tackle this problem. This field of research is becoming increasingly
important as molecular dynamics provides a detailed picture of the biomolecular processes
in solution. It allows to receive the distribution of the thermal properties of molecules and
analyze the ensemble of conformations of the proteins.
We study the structures of archaeal proteins Nip7 from Pyrococcus species from
shallow hydrothermal vents (Pyrococcus furiosus, the depth of habitat is about 100 m)
and deep-sea pezofiles (Pyrococcus abyssi, the depth habitat is about 2200 m) at
different pressures. Nip7 protein participates in ribosomal biogenesis and is involved
in the processing of 27S pre-rRNA and the formation of 60S ribosomal subunits.
We compared computer models of three-dimensional structures of Nip7 proteins
from P. abyssi and P. furiosus at pressures ranging from 0,1 MPa to 200MPa. It was
shown that the deformation of the structure Nip7 shallow P. furiosus is larger than
for the deep-sea P. abyssi. P. furiosus protein had larger structural deformation of the
RNA-binding site at high pressure. Moreover, analysis of computer models of Nip7
proteins from P. abyssi and P. furiosus demonstrated that with the increasing pressure
the solvent-accessible surface area decreases. This area is smaller for models Nip7
P. abyssi and its relative change is less than that from P. furiosus. Obtained results
are consistent with the hypothesis about the importance of protein interaction with the
solvent while the pressure increases.
Key words: protein structure, molecular dynamics, high pressure; pezofiles;
Pyrococcus.
Received May 4, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 146–156
УДК 612.323:577.112.6
Т.А. Томова1, Е.Ю. Просекина2, В.И. Гриднева2, Т.А. Замощина2, 3
Институт культуры Томского государственного педагогического
университета (г. Томск)
2
Биологический институт Томского государственного университета (г. Томск)
3
Сибирский государственный медицинский университет (г. Томск)
1
МОДУЛЯЦИЯ ПЕПТИДАМИ ПРОЛИЛГЛИЦИЛПРОЛИНОМ
И ГЛИЦИЛПРОЛИНОМ ХОЛИНЕРГИЧЕСКИХ ВЛИЯНИЙ
НА СЕКРЕТОРНУЮ АКТИВНОСТЬ ЖЕЛУДКА
Проведено изучение биологической активности пептидов пролилглицилпролина (PGP) и глицилпролина (GP) в отношении секреторной активности желудка,
стимулированной карбахолином, на самцах крыс массой 180–240 г и собак массой
15–22 кг. Показано, что PGP и GP способны модулировать холинергические влияния на желудочную секрецию, причем GP обладал амбивалентной активностью.
Эффект пептида определялся временным интервалом между его введением и
холиномиметика: а) сочетанное введение уменьшало кислотность и содержание фукозы, но увеличивало протеолитическую активность желудочного сока;
б) профилактическое введение GP за 30 мин снижало объем желудочного сока,
кислотность и темп секреции Н+. Характер влияния GP определялся исходным
уровнем желудочной секреции. У животных с исходно высоким уровнем секреции
желудка пептид вызывал увеличение только объёма желудочного сока, тогда
как у животных с исходно низкой секрецией рост объёма сока сопровождался
снижением кислотности, увеличением протеолитической активности и содержания фукозы.
Ключевые слова: желудочная секреция; пептиды; пролилглицилпролин; глицилпролин; карбахолин.
Введение
В настоящее время существует представление о том, что регуляция и координация функций, в том числе желудочно-кишечного тракта (ЖКТ), может осуществляться за счет ключевых фрагментов полипептидов, отщепляющихся от достаточно длинных молекул в соответствии с потребностями
организма [1]. Особого внимания заслуживают простейшие пролинсодержащие пептиды глицилпролин (GP), пролилглицилпролин (PGP), пролилпролилглицилпролин (PPGP), выявленные сравнительно недавно [2, 3].
Они входят в состав известных регуляторных пептидов (бета-казоморфин,
кальцитонин, гастрин), а также некоторых эндогенных и экзогенных белков
(глюторфин, коллаген, эластин). Накопленный экспериментальный материал свидетельствует об участии глицилпролинов в поддержании гомеостаза
слизистой оболочки желудка (СОЖ), оказывая противоязвенное действие
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Модуляция пептидами пролилглицилпролином
147
[4]. Помимо этого, выявлена их способность ускорять заживление уже развившейся язвы желудка [5].
В отличие от других регуляторных пептидов, глицилпролины чрезвычайно высоко стабильны (они обнаруживаются в плазме крови и через 5 ч после
введения) и способны преодолевать протеолиз в ЖКТ, поступая в кровоток в
неизмененном виде, поэтому есть вероятность перспективы применения их
в качестве лекарственных средств [6, 7].
На сегодняшний день характер действия глицилпролинов на функциональное состояние желудка недостаточно изучен. Принимая это во внимание, целью настоящей работы явилось изучение влияния PGP и GP на секреторную активность желудка, стимулированную карбахолином.
Материалы и методики исследования
Острый эксперимент был выполнен на 60 самцах крыс (линия Вистар)
массой 180–240 г. У всех животных проводили операцию по наложению
лигатур на пилорический отдел желудка. Операцию проводили под кратковременным эфирным наркозом, после чего через 90 мин крысам вводили
пептид и стимулятор желудочной секреции. По окончании времени секреции крыс декапитировали, извлекали желудок и содержимое подвергали
анализу. Хронические опыты проведены на 7 беспородных собаках (самцы) весом 15–22 кг с фистулой желудка по Басову. О секреторной функции
желудка животных судили по объему отделяемого секрета, активности Н+,
темпу секреции Н+, протеолитической активности желудочного сока и содержанию фукозы, которая отражает слизеобразующую функцию желудка.
В проведенных исследованиях кислотность оценивалась по активности
Н+, определяемой с помощью pH желудочного сока с последующим вычислением по таблице антилогарифмов и выражалась в мкмоль/мл. Кислотовыделительная функция желудка, соответствующая темпу секреции
Н+, оценивалась вычислением количества выделившихся активных Н+ за
определенный отрезок времени с учетом объема секрета и выражалась в
ммоль [8, 9].
Определение протеолитической активности желудочного сока проводили по методу Ансона и Мирского в модификации А.М. Уголева [10]. Метод
основан на спектрофотометрическом определении выделившегося тирозина после инкубации в стандартных условиях желудочного сока и бычьего
сывороточного лиофилизированного белка альбумина. Измерения проводили на спектрофотометре СФ-46 «ЛОМО» против контроля на длине волны
620 нм. До 95% протеолитической активности обеспечивается основным
ферментом желудочного сока – пепсином. Активность пепсина выражали в
мкмоль тирозина / мл желудочного сока.
Концентрацию фукозы определяли по методу N. Dicshe, L. Shettles [11].
Суть метода определения фукозы заключается в образовании фурфурола и
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
148
Т.А. Томова, Е.Ю. Просекина, В.И. Гриднева, Т.А. Замощина
его производных (метил- и гидроксиметилфурфурол) в результате взаимодействия с концентрированной серной кислотой после гидролиза. Фураны
при последующем прибавлении раствора солянокислого цистеина образуют хромоген, имеющий желто-зеленый цвет.
Измерения проводили на спектрофотометре СФ-46 «ЛОМО» против
контроля на длинах волн 396 и 430 нм. При этом хромогены всех сахаров
поглощают свет λ = 396 нм, а свет с λ = 430 нм поглощается всеми сахарами, кроме метилпентоз, к которым относится фукоза. Разница между
поглощением света при 396 и 430 нм пропорциональна концентрации метилпентоз. Количество фукозы оценивали вычислением концентрации образовавшейся фукозы с учётом объема секреции желудочного сока и выражали в мкмоль.
В качестве стимулятора желудочной секреции использовали карбахолин
(«Reanal», Венгрия), являющийся аналогом ацетилхолина – медиатора, запускающего процесс секреции. Карбахолин вводили внутримышечно крысам в дозе 25 мкг/кг, собакам – 6 мкг/кг. Вызванная секреция с момента
введения стимулятора продолжалась 45 мин у крыс и 2,5 ч у собак (сок собирали каждые 30 мин, что давало возможность оценить влияние пептида
на желудочную секрецию в динамике). При выборе используемых в работе
доз пролинсодержащих пептидов руководствовались ранее установленными их противоязвенными эффектами [3]. PGP (предоставлен Институтом
молекулярной генетики РАН, г. Москва) в дозе 1 мг/кг, GP («Senn Chemicals», Швейцария) в дозе 1 мг/кг крысам вводили внутрибрюшинно в объеме 1 мл на 200 г массы животного. Собакам GP вводили внутривенно в
дозе 70 мкг/кг.
Статистическая обработка результатов исследования и построение графиков выполнены с помощью прикладного пакета Statsoft STATISTICA 6.0.
Вычислялись среднее значение анализируемого показателя (M), стандартная ошибка среднего (m) и критерий значимости, относительно которого
определялся достигаемый уровень значимости (p). Значимость различий
между выборками проводили с использованием непараметрического критерия Манна – Уитни (U-test) и критерия Стьюдента (t) (p < 0,05) [12].
Результаты исследования и обсуждение
Введение крысам PGP на фоне карабахолина увеличивало сокоотделение
на 59%, темп секреции Н+ – практически в 2,5 раза, протеолитическую активность – в 5 раз и количество фукозы на 123% в желудочном секрете по
сравнению с контрольными данными (р < 0,05; табл. 1).
Введение GP на фоне карбахолина не вызывало значимых изменений
объема желудочного сока и темпа секреции Н+, но снижало концентрацию
Н+ на 36% и количество фукозы на 27%, а также увеличивало протеолитическую активность секрета в 3 раза (р < 0,05; табл. 1).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Модуляция пептидами пролилглицилпролином
149
Таким образом, из используемых нами глицилпролинов, в сравнительном плане, наиболее ярко в отношении секреторной активности желудка
проявил себя PGP: пептид потенцировал действие карбахолина, увеличивая
тем самым переваривающую способность органа. GP на фоне стимулятора,
в свою очередь, обнаружил амбивалентную активность, что выражалось в
снижении кислотности, слизеобразующей функции желудка наряду с усилением способности расщеплять белки.
Таблица 1
Влияние PGP и GP на показатели стимулированной карбахолином
желудочной секреции у крыс при одновременном поступлении
в организм холиномиметика и пептида
Контроль – введе- Введение PGP одно- Введение GP одноПоказатели желудоч- ние ФР и карбахо- временно с карбахо- временно с карбаной секреции
лина, M ± m
лином, M ± m
холином, M ± m
(n = 14)
(n = 10)
(n = 10)
Объем желудочного
4,6 ± 0,33
7,3 ± 0,35 *
4,0 ± 0,40
сока, мл
Концентрация Н+,
62,2 ± 3,91
70,2 ± 5,12
40,0 ± 5,37 *
мкмоль/мл
Темп секреции Н+,
269,2 ± 39,17
493,6 ± 50,69 *
204,9 ± 34,47
мкмоль
Протеолитическая
90,9 ± 16,40
518,8 ± 11,34 *
285,5 ± 15,97 *
активность, мкмоль
Содержание фукозы,
4,4 ± 0,44
10,7 ± 1,34 *
3,2 ± 0,31 *
мкмоль
Примечание. Здесь и далее в таблицах и рисунке М – среднее арифметическое значение;
m – стандартная ошибка среднего арифметического; n – количество животных; ФР – физиологический раствор; звездочкой отмечено статистически значимое отличие от контрольной величины (p < 0,05).
Известно, что GP активен по истечении 60 и 90 мин опыта после его
введения [13] и достаточно долго существует в плазме крови [7], поэтому интересным представилось рассмотрение эффективности действия GP
на стимулированную желудочную секрецию, увеличив время регистрации
эффекта пептида. Дипептид вводили за 30 мин до инъекции стимулятора,
что давало возможность продлить время регистрации эффекта пептида до
75 мин и сохранить время желудочной секреции (45 мин), по истечении
которого получали оптимальный объем желудочного сока [14].
При введении GP за 30 мин до карбахолина наблюдали снижение объема
желудочного секрета на 24%, кислотности – на 41% и темпа секреции Н+ – в
2 раза (р < 0,05; табл. 2).
Таким образом, эффект пептида, полученный на 75 мин действия, отличался от того, который был получен на 45 мин. Чувствительность показателей стимулированной желудочной секреции при введении GP зависела от
временного интервала между инъекциями пептида и карбахолина и могла
определяться временем регистрации эффекта с момента введения GP.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
150
Т.А. Томова, Е.Ю. Просекина, В.И. Гриднева, Т.А. Замощина
Для подтверждения возможных особенностей изменения желудочной
секреции во времени необходимо было изучить влияние GP на секреторную активность желудка в динамике соковыделения, исключив временной
фактор в сочетаниях инъекций GP и карбахолина. Для выполнения данной
задачи были введены в эксперимент собаки.
Таблица 2
Изменение показателей секреторной функции желудка у крыс
под влиянием GP, введенного за 30 мин до карбахолина
Показатель желудочной
секреции
Объем желудочного сока, мл
Концентрация Н+, мкмоль/мл
Темп секреции Н+, мкмоль
Протеолитическая активность,
мкмоль
Содержание фукозы, мкмоль
Контроль – введение ФР
за 30 мин до карбахолина, M ± m (n = 14)
4,6 ± 0,33
62,2 ± 3,91
269,2 ± 39,17
Введение GP за 30 мин
до карбахолина,
M ± m (n = 10)
3,5 ± 0,26 *
36,3 ± 5,90 *
146,3 ± 37,09 *
90,9 ± 16,40
144,1 ± 36,68
4,4 ± 0,44
3,7 ± 0,33
В контрольных опытах у собак была обнаружена значительная вариабельность показателей секреторной активности желудка, что позволило
разделить животных на две группы. Для собак первой группы характерна
высокая секреторная активность желудка, что проявилось в значительном
объёме желудочного сока с высоким темпом секреции Н+, протеолитической активностью и содержанием фукозы в желудочном секрете. Во вторую группу отнесены животные со сниженной секреторной активностью
желудка и, соответственно, с низкими значениями показателей секреции по
сравнению с первой группой (р < 0,05; табл. 3).
Таблица 3
Контрольные показатели секреторной активности желудка у собак
Показатель
Суммарный объем секрета, мл
Концентрация H+, мкмоль/мл
Темп секреции Н+, ммоль/2,5 ч
Протеолитическая активность,
мкмоль
Содержание фукозы, мкмоль
Первая группа собак с
исходно высокой секрецией желудка,
M ± m (n = 23)
98,9 ± 7,34
65,1 ± 5,86
7,9 ± 1,13
Вторая группа собак с
исходно низкой секрецией желудка,
M ± m (n = 15)
70,5 ± 7,53 *
64,2 ± 2,74
3,8 ± 0,37 *
7,6 ± 1,71
0,7 ± 0,15 *
22,4 ± 4,06
10,5 ± 1,72 *
Результаты анализа желудочного содержимого в контрольных группах
животных сопоставимы с результатами исследований других авторов [15–
18] и полученными нами ранее данными [19].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Модуляция пептидами пролилглицилпролином
151
Различия между группами в характере секреторного ответа на введение
стимулятора карбахолина являются отражением «индивидуальной нормы»
[15], что обусловлено конституциональными особенностями гуморальной
регуляции и структуры желудочных желез [20].
Изменения показателей секреторной функции желудка собак после введения дипептида определялись исходным уровнем секреторной активности
органа животных. У собак с исходно высокой секреторной активностью желудка введение GP на фоне карбахолина вызывало лишь увеличение объёма
желудочного сока на 80% (р < 0,05; табл. 4).
У собак с исходно низкой секреторной активностью желудка пептид в
сочетании с карбахолином увеличивал объем секрета на 33%, протеолитическую активность – на 171% и содержание фукозы – на 49%, но уменьшал
концентрацию Н+ на 15% (р < 0,05; табл. 4).
Таблица 4
Влияние GP на стимулированную карбахолином желудочную секрецию
у собак с разными уровнями исходной секреции
Контроль – введеВведение GP
Уровень
ние ФР и карбахо- на фоне карбахожелудочной
лина, M ± m
лина, M ± m
секреции
(n1 = 23, n2 = 15)
(n1 = 15, n2 = 14)
Суммарный объём
Высокий
98,8 ± 7,33
158,7 ± 12,18 *
сока, мл
Низкий
70,5 ± 7,53
99,5 ± 6,45 *
Концентрация Н+,
Высокий
65,1 ± 5,86
57,9 ± 3,99
мкмоль/мл
Низкий
64,2 ± 2,74
54,3 ± 1,88 *
Темп секреции Н+,
Высокий
7,9 ± 1,13
8,7 ± 0,82
ммоль
Низкий
4,1 ± 0,47
4,3 ± 0,65
Протеолитическая
Высокий
7,6 ± 1,71
3,7 ± 1,09
активность сока, ммоль
Низкий
0,7 ± 0,15
1,9 ± 0,38 *
Содержание фукозы,
Высокий
22,4 ± 4,06
24,4 ± 3,36
мкмоль
Низкий
10,5 ± 1,72
15,7 ± 1,47 *
Примечание. n1, n2 – количество опытов в группах у собак с исходно высоким и низким
уровнями желудочной секреции соответственно.
Показатель
желудочной секреции
При введении GP в динамике соковыделения отмечены изменения на
протяжении всего эксперимента (2,5 ч), что можно продемонстрировать на
примере протеолитической активности желудочного сока у собак с исходно
низкой секреторной активностью желудка (рис. 1, А).
Необходимо отметить, что у собак этой группы GP вызывал как увеличение на 30 мин опыта темпа секреции Н+, так и его уменьшение на 90 мин
эксперимента (рис. 1, Б). Данный факт можно считать доказательством в
пользу неоднозначности влияния дипептида на изменение продукции соляной кислоты в динамике развития эффекта GP.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Протеолитическаяммоль
активность, ммоль
Протеолитическая активность,
Т.А. Томова, Е.Ю. Просекина, В.И. Гриднева, Т.А. Замощина
0,7
0,6
*
0,5
*
0,4
*
*
0,3
0,2
0,1
0
А
30
60
90
120
150
Темп секреции Н+, ммоль
Время эксперимента, мин
Темп секреции Н+, ммоль
152
2
1,8
1,6
1,4
1,2
1
0,8
0,6
0,4
0,2
0
Б
*
*
30
60
90
120
150
Время эксперимента, мин
Рис. 1. Изменения протеолитической активности (А) и темпа секреции
водородных ионов (Б) в динамике у собак с исходно низкой секреторной
активностью желудка после введения GP: сплошная линия –
карбахолин + физиологический раствор; пунктирная – карбахолин + GP
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Модуляция пептидами пролилглицилпролином
153
Заключение
Дипептид GP – структурный компонент трипептида PGP, обладает самостоятельной физиологической активностью в отношении желудочной секреции, которая зависит от временного интервала между введением пептида и
стимулятора секреции карбахолина:
а) введение GP одновременно с карбахолином уменьшало кислотность
и содержание фукозы, но увеличивало протеолитическую активность желудочного сока;
б) введение GP за 30 мин до карбахолина снижало объем желудочного
сока, кислотность и темп секреции Н+.
Характер влияния GP на секреторную активность желудка определялся
исходным уровнем желудочной секреции. У животных с исходно высоким
уровнем секреции желудка пептид вызывал увеличение только объёма желудочного сока, тогда как у животных с исходно низкой секрецией рост объёма
сока сопровождался снижением кислотности, увеличением протеолитической активности и содержания фукозы.
Таким образом, пролинсодержащие пептиды PGP и GP способны модулировать холинергические влияния на желудочную секрецию. Сохранение эффекта пептидов в течение трех часов после введения, несмотря на
значительное уменьшение их концентрации в крови, вероятно, связано с
высокой тропностью глипролинов к тканям желудка и высокой концентрацией их накопления в тканях этого органа [21], что может вызвать запуск
каскадных реакций, которые изменяют уровень желудочной секреции в зависимости от исходной секреторной активности органа.
На основании полученных результатов и данных литературы в модулирующем действии PGP и GP в отношении секреторной функции желудка
в физиологических условиях могут участвовать как центральные, так и
периферические механизмы регуляции [22].
Во-первых, пептиды PGP и GP могут непосредственно влиять на ткани
желудка [4].
Во-вторых, они могут способствовать синтезу собственных пептидов,
по физико-химическим свойствам близких к изучаемым, которые, возможно, и изменяют секреторную активность.
В-третьих, эффекты PGP и GP могут осуществляться через метаболиты,
образующиеся при деградации пептидов [23].
Эффекты пролинсодержащих пептидов, возможно, связаны с их способностью активировать серотонинергическую систему, увеличивать содержание дофамина и норадреналина, снижать удельную активность
моноаминоксидазы Б и ацетилхолинестеразы, а также увеличивать удельную активность моноаминоксидазы А в структурах мозга [24, 25] и/или
непосредственно взаимодействовать с дофаминовыми рецепторами [26].
Не исключается способность PGP и GP корректировать функциональную
активность желудка посредством включения холинергических механизмов
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
154
Т.А. Томова, Е.Ю. Просекина, В.И. Гриднева, Т.А. Замощина
и/или модулирующего влияния на эффекты ацетилхолина, изменяя чувствительность рецепторов железистых клеток к стимулятору [27].
Литература
1. Тутельян В.А., Хавинсон В.Х., Малинин В.В. Физиологическая роль коротких пептидов
в питании // Бюллетень экспериментальной биологии и медицины. 2003. Т. 135, № 1.
С. 4–10.
2. Ашмарин И.П., Каразеева Е.П. Новые роли высокостабильных олигопептидов, нейротрофинов и иммуномодуляторов в регуляторном континууме // Успехи физиологических наук. 2003. Т. 34, № 1. С. 14–19.
3. Ашмарин И.П., Каразеева Е.П., Ляпина Л.А., Самонина Г.Е. Регуляторная активность
простейших пролинсодержащих пептидов PG, GP, PGP и GPGG и возможные источники их биосинтеза // Биохимия. 1998. Т. 63, вып. 2. С. 149–155.
4. Falalyeyeva T.M., Samonina G.E., Beregovaya T.B. et al. Effect of glyprolines on homeostasis of gastric mucosa in rats with stress ulcers // Bulletin of experimental biology and
medicine. 2010. Vol. 149, № 1. P. 30–33.
5. Труфанова А.В., Багликова К.Е., Бакаева З.В. Гистоморфологические особенности
ускорения заживления ацетатных язв глипролинами // Бюллетень экспериментальной
биологии и медицины. 2007. Т. 144, № 8. С. 226–228.
6. Фалалеева Т.М., Самонина Г.Е., Береговая Т.В. и др. Влияние глипролинов PGP, GP, PG
на гомеостаз слизистой оболочки желудка при этаноловой модели язвообразования
у крыс // Бюллетень экспериментальной биологии и медицины. 2010. Т. 149, № 6.
С. 637–639.
7. Золотарев Ю.А., Жуйкова С.Е., Ашмарин И.П., Мясоедов Н.Ф. Метаболизм пептида
PGP при разных способах введения // Бюллетень экспериментальной биологии и медицины. 2003. Т. 135, № 4. С. 423–426.
8. Канищев П.А., Коваленко Л.Г. О темпе желудочной секреции водородных ионов // Лабораторное дело. 1977. № 12. С. 707–710.
9. Мыш В.Г. Секреторная функция желудка и язвенная болезнь. Новосибирск : Наука,
1987. 176 с.
10. Уголев А.М. Исследование пищеварительного аппарата у человека. Л. : Наука, 1969.
216 с.
11. Коротько Г.Ф. Введение в физиологию ЖКТ. Ташкент : Мед., 1987. 220 с.
12. Лакин Г.Ф. Биометрия : учеб. пособие для биол. спец. вузов. М. : Высш. шк.., 1990.
352 с.
13. Самонина Г.Е., Копылова Г.Н., Сергеев В.И. Коррекция кровотока желудка как один
из возможных механизмов противоязвенных эффектов коротких пролинсодержащих
пептидов // Российский физиологический журнал. 2001. Т. 87, № 11. С. 1488–1492.
14. Бесядовский Р.А., Иванов К.В., Козюра А.К. Справочное руководство для радиобиологов. М. : Атомиздат, 1978. 128 с.
15. Гриднева В.И. Значение исходного уровня показателей желудочной секреции для
реактивности секреторного аппарата желудка в ответ на действие возмущающих
факторов // Доклады Академии наук Высшей школы России. 2004. № 2 (3). С. 106–
118.
16. Кривова Н.А., Дамбаев Г.Ц., Хитрихеев В.Е. Надэпителиальный слизистый слой желудочно-кишечного тракта и его функциональное значение. Томск : РАСКО, 2002. 316 с.
17. Somarundaram K., Ganguly A.K. Gastric mucosal protection during restraint stress in rats:
alteration in gastric adherent mucus and dissolved mucus in gastric secretion // Hepatogastroenterol. 1985. Vol. 32. P. 24–26.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Модуляция пептидами пролилглицилпролином
155
18. Кривова Н.А., Заева О.Б., Ходанович М.Ю. и др. Состояние слизистой оболочки желудка, про- и антиоксидантной активности и биохимических показателей крови у
крыс после скармливания нано- или микрочастиц диоксида титана // Вестник Томского государственного университета. Биология. 2011. № 2 (14). С. 81–95.
19. Замощина Т.А., Никифоров Л.А., Просекина Е.Ю., Томова Т.А. Биологическая активность спиртовых извлечений из ряски малой в отношении процессов воспаления //
Вестник Томского государственного университета. Биология. 2011. № 2 (14). С. 73–81.
20. Дорофеев Г.И., Успенский В.М. Гастродуоденальные заболевания в молодом возрасте.
М. : Медицина, 1984. 214 с.
21. Ашмарин И.П., Багликова К.Е., Эдеева С.Е., Золотарев Ю.А. Сравнительный анализ
распределения глипролинов при разных способах введения // Биоорганическая химия. 2008. Т. 34, № 4. С. 464–470.
22. Самонина Г.Е., Копылова Г.Н., Умарова Б.А. Трипептид Pro-Gly-Pro и гомеостаз слизистой оболочки желудка // Нейрохимия. 2008. Т. 25, №1. С. 128–131.
23. Ашмарин И.П., Самонина Г.Е., Бадмаева К.Е., Бакаева З.В. Регуляторные фрагменты
коллагена в гомеостазе слизистой оболочки желудка // Успехи физиологических наук.
2006. Т. 37, № 2. С. 11–18.
24. Доведова Е.Л., Самонина Г.Е., Монаков М.Ю. и др. Влияние трипептида Pro-Gly-Pro
на катаболизм некоторых медиаторов мозга крыс при пероральном введении этанола
// Нейрохимия. 1998. Т. 15, вып. 2. С. 146–151.
25. Byun H.G., Kim S.K. Structure and activity of angiotensin I converting enzyme inhibitory
peptides derived from Alaskan Pollack skin // J. Biochem. Mol. Biol. 2002. Vol. 35, № 2.
P. 239–243.
26. Мешавкин В.К., Батищева Е.Ю., Кост Н.В. и др. Влияние трипептида Pro-Gly-Pro на
дофаминовую систему // Бюллетень экспериментальной биологии и медицины. 2011.
Т. 151, № 4. С. 410–413.
27. Сергеев П.В., Шимановский Н.Л., Петров В.И. Рецепторы физиологически активных
веществ. Волгоград : Семь ветров, 1999. 640 с.
Поступила в редакцию 21.08.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 146–156
Tatiana A. Tomova1 , Elena Ju. Prosekina2, Vera I. Gridneva2,
Tatiana A. Zamoshchina2, 3
Institute of Culture of Tomsk State Pedagogical University, Tomsk, Russia
2
Biological Institute of Tomsk State University Tomsk, Russia
3
Siberian State Medical University, Tomsk, Russia
1
THE MODULATION OF CHOLINERGIC INFLUENCES
ON GASTRIC SECRETORY ACTIVITY BY
PEPTIDES PROLILGLYCILPROLIN AND GLYCILPROLIN
The results of studying have indicated that peptides prolilglycilprolin (PGP)
and glycilprolin (GP) modulated cholinergic influences on the gastric secretion. The
investigation was carried out on rat males whose weight was 180–240 g and on dog
males within 15–22 kg with Basov fistula of gastric. Th secretory function of stomach
was estimated by gastric juice volume, acidity and tempo secretion of H+ and content
of fucosa, which indicates on mucus secretion. The gastric secretion was stimulated by
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
156
Т.А. Томова, Е.Ю. Просекина, В.И. Гриднева, Т.А. Замощина
carbachol, which was infused intramuscularty: rats – in a dose 25 mkg/kg, dogs – in
a dose 6 mkg/kg. the stimulated gastric secretion continued for 45 min for rats and
2,5 h for dogs (gasrtic juice was gather each 30 minuts). This condition allowed to
estimate peprides influence on gastric secretion in the dinamics. PGP in a dose 1 mg/
kg and GP in a dose 1 mg/kg were entered intraperitonealy for rats (1 ml on 200 g
weight of a body). Also GP in a dose 70 mkg/kg was entered intravenously for dogs.
Statistical procedures spent by means of applied package StatSoft STATISTICA 6.0
with the use of average value of a analyzed indicator (M), a standard error of average
(m), nonparametric criterion Mann-Whitney (U-test) and parametric t-criterion
Student. Differences were significant if p<0,05. The results of experiments have
indicated that peptides PGP and GP modulated cholinergic influences on the gastric
secretion, GP possessed ambivalent activity. The effect of peptide was determined
by time interval of its and cholinomimetic introduction: a) combined introduction
decreased acidity and content of fucosa, but increased proteolytic activity of gastric
juice; b) preventive introduction for 30 minutes decreased gastric juice volume,
acidity and tempo secretion of H+. Also the character of introduction peptide GP was
determined by baseline level of gastric secretion. In a group of animals which had
high baseline level of gastric secretion peptide caused increase only in gastric juice
volume, while in a group of animals which had low baseline level of gastric secretion
peptide infusion increased gastric juice volume, activity of pepsin, secretion of mucus
and diminished acidity.
Key words: gastric secretion; peptides; prolilglycilprolin; glycilprolin; carbachol.
Received August 21, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 157–169
ЦИТОЛОГИЯ И ГЕНЕТИКА
УДК 575.1::576.3
Г.Н. Артемов1,2, Г.М. Абылкасымова3, В.Н. Стегний1,2
Особое структурное подразделение «Научно-исследовательский институт биологии
и биофизики Томского государственного университета» (г. Томск)
2
Биологический институт Томского государственного университета (г. Томск)
3
Институт общей генетики и цитологии Комитета науки Министерства образования
и науки Республики Казахстан (г. Алма-Ата, Казахстан)
1
МОЛЕКУЛЯРНО-ЦИТОГЕНЕТИЧЕСКИЙ АНАЛИЗ РАЙОНА
ПРИКРЕПЛЕНИЯ ХРОМОСОМ К ЯДЕРНОЙ ОБОЛОЧКЕ
ТРОФОЦИТОВ МАЛЯРИЙНЫХ КОМАРОВ Anopheles
КОМПЛЕКСА «maculipennis»
Работа выполнена в рамках ФЦП «Научные и научно-педагогические кадры
инновационной России», 2009–2013 гг. (ГК № П801; № П1702, № 02.740.11.0278),
АВЦП «Развитие научного потенциала высшей школы (2009–2010 гг.)»
(проект № 2.1.1/774) и при финансовой поддержке РФФИ «Научная работа
молодых ученых из стран СНГ в российских научных организациях»
моб_снг_ст 2011 г. (грант № 11-04-90911).
Проведен сравнительный молекулярно-цитогенетический анализ районов
прикрепления хромосом к ядерной оболочке трофоцитов пяти видов малярийных комаров Anopheles комплекса «maculipennis». Методом флуоресцентной in
situ гибридизации изучали локализацию ДНК, гомологичной району прикрепления
XL хромосомы Anopheles messeae Fall., на хромосомах близкородственных видов.
Показано, что район прикрепления XL хромосомы An. messeae является гетерохроматическим и соответствует топологии β-гетерохроматина. Выявлено, что
ДНК района прикрепления XL хромосомы An. messeae локализуется в интеркалярных районах и прицентромерном гетерохроматине хромосом малярийных комаров комплекса «maculipennis», а также в прицентромерном α-гетерохроматине у
An. maculipennis и An. messeae. Показаны различия изучаемых видов по распределению ДНК, гомологичной последовательностям района прикрепления XL хромосомы An. messeae, на хромосомах близкородственных видов. Обсуждается вопрос
возникновения районов прикрепления хромосом к ядерной оболочке.
Ключевые слова: пространственная организация ядра; районы прикрепления
хромосом к ядерной оболочке; гетерохроматин; малярийные комары; Anopheles.
Введение
Проблема пространственной организации интерфазного ядра изучается
уже более 125 лет [1] и остается до сих пор актуальной [2–4]. Гены, хромосомные сегменты и геном как целое упорядочены в трехмерном простран-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
158
Г.Н. Артемов, Г.М. Абылкасымова, В.Н. Стегний
стве ядра [5]. Этот порядок обеспечивается взаимодействием хромосом с
ядерной оболочкой и друг с другом [6]. Малярийные комары являются исключительно удобным объектом для изучения хромосомо-мембранных отношений, так как близкородственные виды этих насекомых различаются
по пространственной организации хромосом в ядрах трофоцитов яичников
[7]. Наибольший интерес представляет изучение молекулярной организации
районов хромосом, взаимодействующих с ядерной оболочкой. Выяснение
природы контактов хромосом с оболочкой ядра позволит получить представление о закономерностях формирования и функционирования хроматина во внутриядерном пространстве.
Флуоресцентная in situ гибридизация ДНК отдельных районов хромосом,
полученной с помощью микродиссекции, с хромосомами близкородственных
видов малярийных комаров успешно применяется для оценки реорганизации последовательности ДНК районов прикрепления хромосом в филогенезе
[8–10]. Ранее был проведен подобный анализ ДНК прицентромерного района
хромосомы 2R Anopheles atroparvus Thiel., имеющего факультативные связи
с оболочкой ядра [8], и района прикрепления 2L хромосомы An. beklemishevi
Steg. et Kab. [9, 11]. В этих работах было показано, что районы прикрепления хромосом, которые находятся в прицентромерных районах, имеют общие последовательности ДНК с прицентромерными районами хромосом
близкородственных видов, причем вне зависимости от их способности образовывать жесткий контакт с ядерной оболочкой. Можно сделать вывод, что
исследованные прицентромерные районы хромосом содержат консервативные повторы, характерные для прицентромерных районов как таковых, а не
только для районов прикрепления хромосом к оболочке ядра.
Цель настоящего исследования – выяснить, имеет ли район прикрепления XL хромосомы An. messeae Fall. общие последовательности с районами прикрепления хромосом других видов малярийных комаров комплекса
«maculipennis». XL хромосома An. messeae образует контакт с ядерной оболочкой посредством района 2b-c, который расположен в середине плеча [7]. Район
2b-c локализуется на периферии ядра и образует «отростки», контактирующие
с ядерной оболочкой, которые можно наблюдать на полудавленных препаратах
ядер трофоцитов (рис. 1, на вклейке) и с использованием метода 3D-FISH ДНК
района 2b-c с ядрами трофоцитов An. messeae (рис. 2, на вклейке).
Изучение последовательности ДНК района 2b-c интересно тем, что он
не является прицентромерным. Поэтому становится возможным провести
анализ района, ответственного за контакт с ядерной оболочкой, «в чистом
виде», исключив последовательности, характерные для прицентромерного
гетерохроматина. В данной работе исследовали локализацию ДНК района
прикрепления XL хромосомы An. messeae на хромосомах близкородственных видов малярийных комаров, что позволило судить о реорганизации
ДНК районов хромосом, принимающих участие в пространственной организации хромосом в ядре.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Молекулярно-цитогенетический анализ района
159
Материалы и методики исследования
В качестве материала для исследования использовали малярийных комаров Anopheles комплекса «maculipennis». Самки An. messeae и An. beklemishevi
были собраны в пос. Коларово (Томская область) и в с. Тегульдет (Томская
область), самки An. maculipennis Mg. и An. melanoon Hackett. собраны в
окрестностях г. Адлер (Краснодарский край), а самки An. atroparvus были
взяты из лабораторной культуры.
Приготовление препаратов хромосом. Для приготовления воздушно-сухих препаратов политенных хромосом яичники самок малярийных комаров
фиксировали в растворе Карнуа (96%-ный этанол с ледяной уксусной кислотой в соотношении 3:1). Препараты готовили по стандартной методике [12].
Фолликулы яичников малярийного комара выдерживали 5 мин в 50%-ной
пропионовой кислоте на предметном стекле. Затем материал накрывали покровным стеклом и раздавливали. Препарат опускали в жидкий азот, покровное стекло удаляли. После этого осуществляли проводку в этиловом спирте
с возрастающей концентрацией (50, 70, 96%) по 5 мин в каждом при –20°С.
Препараты высушивали при комнатной температуре.
Флуоресцентная in situ гибридизация. Метод флуоресцентной in situ
гибридизации (FISH) применяется для определения локализации на хромосомах исследуемой последовательности ДНК. Исследуемую ДНК (ДНКзонд) «окрашивают» с помощью флуоресцентного красителя, денатурируют
и гибридизуют с ДНК воздушно-сухих препаратов хромосом, распластанных на предметных стеклах. ДНК-зонд гибридизуется с ДНК хромосом по
принципу комплементарности и выявляется при анализе с использованием
люминесцентного микроскопа. В качестве ДНК-зонда в работе использована ДНК, полученная с помощью микродиссекции из района прикрепления
XL хромосомы к оболочке трофоцитов An. messeae. Для его приготовления
использовали модифицированный нуклеотид тетрамелилродамин-5-дУТФ
(TAMRA, ЗАО «Биосан», Россия). FISH с таким зондом позволяет опустить
этап детекции, так как флуорохром уже связан с модифицированным нуклеотидом. В данной работе использовали стандартный протокол FISH [13] с
модификациями, приведенными ниже.
Введение метки в ДНК. Введение метки в ДНК проводили в 25 циклах
ПЦР в режиме: денатурация 94°С – 1 мин; отжиг 56°С – 1,5 мин; элонгация
цепей при 72°С – 2 мин; с завершающей элонгацией цепей при 72°С – 8 мин.
Состав ПЦР-смеси: 10 mМ Трис НС1; 50 mM KC1, рН 8,3; 200 мкМ дАТФ,
дЦТФ, дГТФ и 100 мкМ дТТФ; 100 мкМ тетраметилродамин-5-дУТФ;
2 мкМ праймера MW6 (ООО «СибЭнзим-М», Россия), 5 мМ MgCl2 и 1,5 ед.
Taq ДНК полимеразы. Полученный зонд промывали в 96%-ном этаноле 12 ч
при –20°С, а далее – в 70%-ном этаноле при комнатной температуре 10 мин
в присутствии 1:10 объема ПЦР смеси ацетата натрия 3 М с последующим
высушиванием при 52°С в твердотельном термостате. Осадок зонда смешивали с гибридизационной смесью.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
160
Г.Н. Артемов, Г.М. Абылкасымова, В.Н. Стегний
In situ гибридизация. Воздушно-сухие препараты промывали три раза в
буферном растворе 2×SSC (37°C, по 5 мин в каждом), проводили по серии
этиловых спиртов возрастающей концентрации (70, 80, 96%) и высушивали при комнатной температуре. Далее препараты подвергались обработкой
пепсином (200 мкг/мл) в кислой среде (10 мM HCl) 10 мин при 37°С, после чего следовали отмывка в двух сменах 1×PBS и дегидратация в серии
спиртов возрастающей концентрации. На препараты наносили ДНК-зонд в
гибридизационной смеси (50%-ный формамид, 10%-ный декстрансульфат
натрия, 1%-ный Tween 20, 2×SSC) из расчета 15 мкл на один препарат. Препараты помещали на ночь в гибридизационную камеру «Termobrite» с режимом работы: денатурация 5 мин при 72°С и гибридизация 15 ч при 37°С.
Отмывку препаратов от лишнего зонда осуществляли в трех сменах
50% -ного формамида в 2×SSC при 42°С с покачиванием по 5 мин в каждой.
Далее препараты помещали последовательно в 2×SSC, 2×SSC с 0,1%-ным
Tween 20, две смены 0,2×SSC при 42°С и 0,1×SSC при 60°С по 5 мин в каждом. Препараты дегидратировали в этиловом спирте с возрастающей концентрацией (70, 80, 96%). Окраску хроматина осуществляли с помощью DAPI.
Препараты анализировали на люминесцентном микроскопе AxioImager Z1
(«Zeiss», Германия), фиксацию и обработку изображений проводили с использованием программного обеспечения AxioVision Rel. 4.7 («Zeiss», Германия).
Результаты исследования и обсуждение
Исследование локализации ДНК, гомологичной последовательностям
района прикрепления XL хромосомы An. messeae, на хромосомах
малярийных комаров комплекса «maculipennis»
Была проведена флуоресцентная in situ гибридизация ДНК района 2b-c
XL хромосомы An. messeae (ДНК-пробы), полученной с помощью микродиссекции, с политенными хромосомами трофоцитов An. messeae и близкородственных видов An. atroparvus, An. beklemishevi, An. maculipennis и
An. melanoon.
XL хромосома. В популяциях An. messeae с большой частотой встречается, а в западной части ареала преобладает парацентрическая инверсия в
левом плече X хромосомы – XL0 [14]. Эта инверсия распространена как в
гетерозиготном (XL01), так и в гомозиготном (XL00) состояниях, причем показано, что инверсионный полиморфизм популяций малярийного комара
имеет адаптивный характер [14, 15]. Примечательно, что инверсия в ХL хромосоме захватывает район прикрепления к ядерной оболочке и переносит
его из середины плеча к центромере. У особей An. messeae, гомозиготных
по инверсии, положение района прикрепления XL хромосомы аналогично
таковому у эволюционно исходного An. atroparvus. Было обнаружено, что
гомологичные исследуемой последовательности ДНК локализованы также
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Молекулярно-цитогенетический анализ района
161
в прицентромерном районе вблизи к гетерохроматическому правому плечу
хромосомы и инверсией переносятся в середину плеча (рис. 3, на вклейке).
Таким образом, in situ гибридизация ДНК-пробы со стандартным вариантом XL хромосомы An. messeae и гомозиготным по инверсии демонстрирует изменение положения данного района. Причем ДНК-проба гибридизуется с прицентромерным как β-, так и α-гетерохроматином XL хромосомы
An. messeae.
Подобные результаты были получены при гибридизации ДНК-пробы с XL
хромосомой других видов малярийных комаров комплекса «maculipennis»
(рис. 4, на вклейке).
Сигнал был обнаружен в XL хромосоме у всех изучаемых видов, вероятно, в районах, гомейологичных району 2b-c XL хромосомы An. messeae.
Высокая интенсивность сигнала свидетельствует о сходстве последовательностей ДНК этих районов и района 2b-c An. messeae. В прицентромерном
районе XL хромосомы также наблюдали локализацию ДНК-пробы из района 2b-c XL хромосомы An. messeae. Сигнал был обнаружен у An. atroparvus,
An. beklemishevi и An. melanoon только в β-гетерохроматине, у An. maculipennis
так же, как и у An. messeae, сигнал в прицентромерном районе был слабым,
но локализовался как в β-, так и α-гетерохроматине. Высокая интенсивность
сигнала в районе интеркалярного гетерохроматина свидетельствует о том,
что «эволюция» XL хромосомы в комплексе «maculipennis» не происходила
путем хромосомных перестроек, по крайней мере, вовлекающих районы, гомейологичные изучаемому 2b-c An. messeae.
Районы XL хромосом, ответственные за крепление к оболочке ядра
у изучаемых видов, имели сходные последовательности с районом 2b-c
An. messeae, однако интенсивность сигнала различалась. Хотя специальной количественной оценки интенсивности сигнала не проводилось, во
всех экспериментах наиболее яркие сигналы были обнаружены в районах,
гомейологичных району 2b-c An. messeae, и районе прикрепления XL хромосомы An. atroparvus (прицентромерный район). Непростая ситуация возникла с идентификацией сигнала в районе прикрепления XL хромосомы
An. beklemishevi. Гибридизация с этим районом выявлена не во всех экспериментах и была чрезвычайно слабой. Это свидетельствует о том, что гомология ДНК района 2b-c An. messeae и района прикрепления XL An. beklemishevi
либо имеет место (лишь в отношении отдельных малопредставленных у
An. beklemishevi последовательностей), либо отсутствует полностью.
Сигнал в прицентромерном α-гетерохроматине XL хромосом можно
было обнаружить только у An. messeae и An. maculipennis. Обнаружение сигнала в блоках α-гетерохроматина является типичным для указанных видов
и обсуждается ниже.
Таким образом, у всех изучаемых видов, в том числе и у An. messeae, в
XL хромосоме было обнаружено два флуоресцентных сигнала – в прицентромерном районе и в середине плеча (у An. atroparvus два сигнала). Такое
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
162
Г.Н. Артемов, Г.М. Абылкасымова, В.Н. Стегний
же распределение сигналов было отмечено у An. melanoon, XL хромосома
которого не имеет жестких контактов с оболочкой ядра.
Хромосома 2. У большинства изучаемых видов хромосома 2 не имеет
связи с ядерной оболочкой, но у An. beklemishevi хромосома 2 образует контакт с оболочкой ядра в прицентромерной области, и на давленых препаратах правое и левое плечи отделены друг от друга [16]. Обнаружена гомология ДНК-пробы с прицентромерным районом хромосомы 2 всех видов
(рис. 5, на вклейке).
При этом происходило мечение как прицентромерного β-гетерохроматина,
так и α-гетерохроматина. α-гетерохроматин в прицентромерных районах
выражен у An. maculipennis и An. messeae наиболее сильно; он представлен довольно крупными блоками, и гибридизация происходила именно с
ними, в то время как у An. beklemishevi и An. melanoon таких сигналов не
выявлено. Следует отметить также интенсивное мечение прицентромерного
β-гетерохроматина, наиболее ярко выраженное у An. atroparvus, а также в
виде ярких отдельных сигналов у An. melanoon, An. beklemishevi и в меньшей степени у An. maculipennis и An. messeae. Кроме того, сигналы были
обнаружены по всей длине обоих плеч хромосомы 2 всех видов.
Хромосома 3. В трофоцитах самок всех изучаемых видов хромосома 3
крепится к оболочке ядра, и на препаратах плечи этой хромосомы разобщены [16]. В результате FISH ДНК-пробы района 2b-c XL хромосомы в прицентромерном районе правого плеча хромосомы 3 пометились тяжи района
32d, которые отвечают за прикрепление этой хромосомы к оболочке ядра у
всех видов комаров комплекса «maculipennis» (рис. 6, на вклейке). В прицентромерной области этой хромосомы были также обнаружены сигналы,
среди которых следует отметить сигналы в районе, находящемся дистальнее
α-гетерохроматического блока района 32d у An. melanoon, An. atroparvus и
An. beklemishevi. У An. maculipennis и An. messeae таких сигналов обнаружено не было. Однако следует отметить, что лишь у видов An. maculipennis и
An. messeae гибридизация происходила с α-гетерохроматическим блоком района 32d, в то время как у остальных видов сигнала в этом районе не выявлено.
В левом плече хромосомы 3 был обнаружен сигнал в прицентромерном
районе 33 а-с (рис. 7, на вклейке), которым плечо крепится к ядерной оболочке. Следует отметить, что сигналы имеют место и в районах интеркалярного гетерохроматина. Причем часть из них можно было наблюдать в
районах интеркалярного α-гетерохроматина у An. beklemishevi, An. atroparvus, An. melanoon и An. maculipennis. В то время как у An. beklemishevi и
An. atroparvus отмечен сигнал в маркерном районе 35b, у An. maculipennis
и An. melanoon – в характерном гетерохроматическом блоке района 34b.
Однако следует отметить, что в районах прикрепления 3L хромосомы ни
An. melanoon, ни An. maculipennis сигнала обнаружено не было.
Флуоресцентная in situ гибридизация ДНК района прикрепления XL
хромосомы An. messeae с хромосомами того же вида и видов комплекса
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Рис. 1. Локализация тяжей хроматина, контактирующих с оболочкой в районе
2b-c XL хромосомы трофоцитов An. messeae (указаны стрелками):
N – ядрышко; С – центромера. Масштабная линейка 20 мкм
Рис. 2. Ядра трофоцитов An. messeae: красная область – пространственное
положение района 5а XL хромосомы, зеленая – 2b-c XL хромосомы
Рис. 3. Локализация ДНК района 2b-c An. messeae на стандартном варианте XL хромосомы (XL11)
и гомозиготе по инверсии (XL00) у малярийного комара An. messeae; стрелками указана локализация
флуоресцентного сигнала. Масштабная линейка 20 мкм
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Рис. 4. Локализация ДНК района 2b-c XL хромосомы An. messeae на XL хромосоме малярийных комаров комплекса «maculipennis»:
а – XL An. messeae; б – XL An. atroparvus; в – XL An. beklemishevi; г – XL An. maculipennis; д – XL An. melanoon; здесь и далее на рисунках
стрелками показана локализация флуоресцентного сигнала, стрелки синего цвета указывают на сигналы в районах прикрепления хромосом;
стрелками со звездочкой показан сигнал в α-гетерохроматическом районе; С – центромера. Масштабная линейка 20 мкм
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Рис. 5. Локализация ДНК района 2b-c XL хромосомы An. messeae на хромосоме 2 малярийных комаров комплекса «maculipennis»:
а – 2 An. messeae; б – 2 An. atroparvus; в – 2 An. beklemishevi; г – 2 An. maculipennis; д – 2 An. melanoon. Масштабная линейка 20 мкм
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Рис. 6. Локализация ДНК района 2b-c An. messeae на хромосоме 3R малярийных комаров комплекса «maculipennis»:
а – 3R An. messeae; б – 3R An. atroparvus; в – 3R An. beklemishevi; г – 3R An. maculipennis; д – 3R An. melanoon. Масштабная линейка 20 мкм
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Рис. 7. Локализация ДНК района 2b-c An. messeae на хромосоме 3L малярийных комаров комплекса «maculipennis»:
а – 3L An. messeae; б – 3L An. atroparvus; в – 3L An. beklemishevi; г – 3L An. maculipennis; д – 3L An. melanoon. Масштабная линейка 20 мкм
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Молекулярно-цитогенетический анализ района
163
«maculipennis» показала, что этот район характеризуют последовательности
прежде всего прицентромерного гетерохроматина. На данном этапе исследования можно сделать вывод о том, что, вероятно, район 2b-c является гетерохроматическим, что подтверждается работами по локализации высокоповторенной ДНК на хромосомах An. messeae [17, 18]. Ранее отмечалось, что
район 2b-c имеет морфологию, обычную для β-гетерохроматина [16].
Предположение о том, что район 2b-c An. messeae характеризуется последовательностями, типичными только для районов прикрепления хромосом,
не подтвердилось, так как:
1. Примерно одинаковую картину гибридизации ДНК-пробы наблюдали
со всеми хромосомами разных видов вне зависимости от их отношения к
ядерной оболочке. XL хромосома An. melanoon и хромосома 2 An. messeae,
An. maculipennis, An. atroparvus и An. melanoon не образуют жестких контактов с оболочкой ядра, но имеют аналогичное распределение сигнала, что и
хромосомы, взаимодействующие с ядерной оболочкой.
2. У An. beklemishevi в районе прикрепления XL хромосомы, а также в
районах прикрепления 3L хромосомы у An. maculipennis и An. melanoon, не
было обнаружено выраженных сигналов.
Вероятно, ДНК района прикрепления XL хромосомы An. messeae образуют повторенные последовательности разных классов, среди которых есть
универсальные для гетерохроматических районов и те, которые определяют
положение XL хромосомы в пространстве.
Очевидно, что в состав района 2b-c входят последовательности, характерные для β-гетерохроматина. Однако гибридизация зонда была обнаружена также и с α-гетерохроматиновыми блоками, которые расположены
в левом плече хромосомы 2 и правом плече хромосомы 3, что показано в
результате эксперимента FISH ДНК-пробы с хромосомами An. maculipennis
и An. messeae. Важным результатом эксперимента является иллюстрация
различия в локализации гетерохроматических районов у разных видов комплекса «maculipennis» (рис. 8).
An. beklemishevi (25)
An. atroparvus (28)
An. maculipennis (20)
An. labranchiae
An. melanoon (20)
An. messeae (14)
Рис. 8. Изменение количества сайтов консервативных последовательностей ДНК
в филогенезе малярийных комаров комплекса «maculipennis»: в скобках –
количество сигналов, полученных в результате FISH ДНК района 2b-c An. messeae
с хромосомами соответствующих видов малярийных комаров.
Схема видообразования по Стегнию [17] с изменениями
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
164
Г.Н. Артемов, Г.М. Абылкасымова, В.Н. Стегний
Было выявлено, что согласно схеме видообразования [17] происходило
уменьшение количества сайтов, содержащих последовательности ДНК района
прикрепления XL хромосомы An. messeae. Так, у стволового вида An. atroparvus
можно наблюдать 28 сайтов включения метки, у гомосеквентных An. melanoon
и An. maculipennis – 20 сайтов, а у An. messeae – лишь 14 сайтов.
Причем можно предположить, что у An. maculipennis и An. messeae одновременно с элиминацией (или уменьшением) количества консервативных
последовательностей в интеркалярном гетерохроматине происходит их накопление (либо образование de novo) в прицентромерном α-гетерохроматине
хромосом 2, 3R и XL (рис. 9).
An. beklemishevi (1)
An. atroparvus (2)
An. maculipennis (3)
An. labranchiae
An. melanoon (1)
An. messeae (3)
Рис. 9. Изменение количества сайтов консервативных последовательностей ДНК
в α-гетерохроматине в филогенезе малярийных комаров комплекса «maculipennis»:
в скобках – количество сигналов в α-гетерохроматических районах, полученных
в результате FISH ДНК района 2b-c An. messeae с хромосомами соответствующих
видов малярийных комаров. Схема видообразования по Стегнию [17] с изменениями
Такой вывод становится более убедительным, если учитывать, что у
An. atroparvus, An. melanoon, An. beklemishevi указанное на рис. 9 количество
сигналов соответствует только тем, которые расположены в интеркалярном
α-гетерохроматине. Таким образом, район 2b-c, как показал анализ, соответствует β-гетерохроматину не только морфологически, но и по последовательностям ДНК, видимо, эволюционно консервативным.
Сравнительный анализ ДНК районов прикрепления XL хромосомы
An. messeae и 2L хромосомы An. beklemishevi, а также
прицентромерного района 2R хромосомы An. atroparvus
Ранее с помощью микродиссекции были получены ДНК-пробы районов 15d An. beklemishevi [9, 11] и 14с An. atroparvus [8, 19]. Хромосома 2 у
An. beklemishevi крепится к оболочке ядра, и оба плеча на препаратах разобщены. Из прицентромерного района 2L плеча была взята ДНК-проба, и из
нее был приготовлен ДНК-зонд. С использованием этого ДНК-зонда была
проведена FISH с хромосомами An. beklemishevi, An. messeae и An. atroparvus.
Та же работа была проведена и с прицентромерным районом 2R хромосомы An. atroparvus, которая образует факультативные контакты с оболочкой
ядра. Так как в описываемых работах анализировали районы прикрепления
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Молекулярно-цитогенетический анализ района
165
хромосом трофоцитов малярийного комара комплекса «maculipennis», интересно провести сравнение результатов упомянутых работ с результатами
исследования района 2b-c An. messeae. Результат сравнения ДНК-проб районов 15d An. beklemishevi, 14c An. atroparvus и 2b-c An. messeae на хромосомах
An. beklemishevi, An. messeae и An. atroparvus проиллюстрирован в таблице.
Вид
Хромосома
Локализация ДНК районов 15d An. beklemishevi, 14c An. beklemishevi и 2b-c
An. messeae на хромосомах An. beklemishevi, An. messeae и An. Atroparvus
ДНК районов хромосом
15d An. beklemishevi
14с An. atroparvus
2b-c An. messeae
An. atroparvus
An. messeae
An.
beklemishevi
XL
β-ПГХ
β-ПГХ
β-ПГХ, ДР
РП (β-ПГХ)
2L
–
РП (β-ПГХ), ДР
РП (β-ПГХ)
РП (β-ПГХ)
2R
РП (β-ПГХ), ДР
РП (β-ПГХ)
РП (β-ПГХ)
3R
РП (β-ПГХ), ДР
РП (β-ПГХ)
РП (β-ПГХ)
3L
РП (β-ПГХ), ДР
XL
β-ПГХ
β-ПГХ
РП, β-ПГХ, α-ПГХ
2L
β-ПГХ
α-ПГХ
β-ПГХ, α-ПГХ
2R
ДР
β-ПГХ
β-ПГХ
3R
РП (β-ПГХ),α-ПГХ
РП (β-ПГХ),α-ПГХ
РП (β-ПГХ), α-ПГХ
РП (β-ПГХ)
РП (β-ПГХ)
3L
РП (β-ПГХ), ДР
РП (β-ПГХ)
XL
РП (β-ПГХ), ДР
РП (β-ПГХ), ДР
2L
β-ПГХ
β-ПГХ
β-ПГХ, ДР
2R
β-ПГХ
β-ПГХ
β-ПГХ, ДР
РП (β-ПГХ)
РП (β-ПГХ)
3R
РП (β-ПГХ), ДР
РП (β-ПГХ)
РП (β-ПГХ)
3L
РП (β-ПГХ), ДР
Примечание. ПГХ – прицентромерный гетерохроматин; РП – район прикрепления; ДР –
другие районы.
ДНК изучаемых районов, как правило, локализовалась в β-гетерохроматине An. atroparvus и An. beklemishevi, а также в β-гетерохроматине и
α-гетерохро-матиновых блоках An. messeae. Гомология района 2b-c XL хромосомы An. messeae с прицентромерными районами говорит о том, что в
его состав входят повторяющиеся последовательности ДНК, которыми изобилует прицентромерный гетерохроматин. Кроме того, у изучаемых районов сходная картина распределения сигнала на хромосомах близкородственных видов, что является еще одним подтверждением гетерохроматической
природы района 2b-c An. messeae. Однако локализация ДНК-пробы 2b-c
An. messeae, взятой из района интеркалярного гетерохроматина, отличалась
от локализации ДНК-проб района 15d An. beklemishevi и 14с An. atroparvus,
которые были выделены из прицентромерных районов хромосом. Отличие
последовательностей из района 2b-c An. messeae заключается в локализации
их вдоль плечей хромосом наряду с прицентромерным гетерохроматином.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
166
Г.Н. Артемов, Г.М. Абылкасымова, В.Н. Стегний
В результате гибридизации ДНК районов прицентромерного гетерохроматина 2L хромосом An. beklemishevi и 2R An. atroparvus и хромосомой
An. messeae не было выявлено гомологии с районом прикрепления XL хромосомы. Однако гибридизация ДНК-пробы района 2b-c XL хромосомы
An. messeae дала положительный результат. Эти данные еще раз подтверждают сложность организации последовательности ДНК района прикрепления XL хромосомы An. messeae, в состав которого, вероятно, входят последовательности разных классов и с разной копийностью.
Заключение
Таким образом, последовательность ДНК района 2b-c не является принципиально отличной от других районов, имеющих морфологию
β-гетерохроматина, в том числе хромосом, не имеющих контактов с оболочкой ядра. Морфологическое сходство этого района с β-гетерохроматином политенных хромосом лежало в основе гипотезы происхождения этого района
[15, 20]. Ранее предполагалось, что эволюционно исходным инверсионным
вариантом является тот, у которого район 2b-c расположен в прицентромерной области. Однако эксперименты FISH ДНК района прикрепления XL
хромосомы An. messeae с хромосомами близкородственных видов показывают, что у предковых видов и даже представителя неарктической ветви комплекса An. beklemishevi гомейологичный району 2b-c район всегда находится в середине плеча XL хромосомы.
Таким образом, возникновение у An. messeae хромосомы с районом
прикрепления, расположенным в центральной части плеча, было вызвано
реорганизацией самой последовательности ДНК и не связано с хромосомными перестройками. Возникновение районов прикрепления хромосом к
ядерной оболочке у малярийных комаров комплекса «maculipennis» могло быть вызвано перемещением мобильных элементов, содержащих SAR/
MAR-последовательности ДНК. SAR/MAR-последовательности ДНК, которые стабилизируют хроматиновые петли в интерфазном ядре и участвуют в
прикреплении их к ядерному каркасу [21]. Следовательно, эти участки ДНК
имеют непосредственное отношение к формированию внутриядерной архитектуры. Помимо стабилизации хроматиновых петель, SAR/MAR также
участвуют в процессах инициации репликации, транскрипции, репарации и
сплайсинга [21].
В литературе отмечают, что некоторые мобильные элементы, такие как
MITE, способны перемещать SAR/MAR-последовательности [22]. Появление района прикрепления XL хромосомы в середине плеча могло быть
связано с перемещением мобильных элементов из районов прикрепления
хромосом 2 или 3 предкового вида, которые захватывали последовательности, связывающие белки оболочки. Более того, такое перемещение могло
бы произойти в пределах одной XL хромосомы, когда район прикрепления,
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Молекулярно-цитогенетический анализ района
167
расположенный у центромеры, являлся донором функциональных элементов, участвующих в контакте. «Старый» район прикрепления мог утратить
свое значение и перестать функционировать, в то время как «новый», расположенный в середине плеча, принял на себя его функции. Описанная гипотеза возникновения de novo районов прикрепления хромосом подтверждается
данными о молекулярно-генетической структуре района 2b-c, в котором найдены мобильные элементы и SAR/MAR-последовательности [18]. Однако в
настоящий момент существует очень мало информации о молекулярной организации районов прикрепления хромосом к ядерной оболочке, что не позволяет делать окончательных выводов не только о том, как возникли, но и
том, как функционируют эти районы.
Литература
1. Rabl C. Über Zellteilung // Morphologisches Jahrbuch. 1885. P. 214.
2. Cremer T., Cremer C. Chromosome territories, nuclear architecture and gene regulation in
mammalian cells // Nature Reviews Genetics. 2001. Vol. 2, № 4. P. 292–301.
3. Meaburn K.J., Misteli T.J. Locus-specific and activity-independent gene repositioning during
early tumorigenesis // The Journal of Cell Biology. 2008. Vol. 180, № 1. P. 39–50.
4. Mahy N.L., Perry P.E., Bickmore W.A. Gene density and transcription influence the localization of chromatin outside of chromosome territories detectable by FISH // The Journal of
Cell Biology. 2002. Vol. 159, № 5. P. 753–63.
5. Steffensen D.M. Chromosome architecture and the interphase nucleus: Data and theory on
the mechanism differentiation and determination // Chromosomes Today. Amsterdam : Elsevier, 1977. Vol. 6. P. 247–253.
6. Куличков В.А., Жимулев И.Ф. Анализ пространственной организации геномов Drosophila melanogaster на основе данных по эктопической конъюгации политенных хромосом // Генетика. 1976. Т. 12, № 5. С. 81–89.
7. Стегний В.Н. Реорганизация структуры интерфазных ядер в онто- и филогенезе малярийных комаров // Доклады AН СССР. 1979. Т. 249, № 5. С. 1231–1234.
8. Грушко О.Г., Шарахова М.В., Шевченко А.И. и др. Характеристика и сравнительный анализ ДНК из прицентромерного гетерохроматина хромосомы 2 Anopheles
atroparvus V. Tiel (Culicidae, Diptera) // Генетика. 2004. Т. 40, № 10. С. 1325–1334.
9. Стегний В.Н., Сайджафарова А.О., Артемов Г.Н., Карамышева Т.В., Рубцов Н.Б.
Сравнительный анализ молекулярного состава прицентромерного гетерохроматина политенных хромосом малярийных комаров рода Anopheles (CULICIDAE,
DIPTERA) // Вестник Томского государственного университета. Биология. 2007.
№ 1. С. 96–105.
10. Усов К.Е., Шелковникова Т.А., Вассерлауф И.Э., Стегний В.Н. Молекулярно-цитогенетический анализ прицентромерного гетерохроматина хромосом трофоцитов яичников у видов подгруппы Drosophila melanogaster // Цитология. 2008. Т. 50, № 12.
С. 1044–1049.
11. Сайджафарова А.О., Артемов Г.Н., Карамышева Т.В. и др. Молекулярно-цитогенетическое изучение ДНК прицентромерного гетерохроматина хромосомы 2L у малярийного комара Anopheles beklemishevi (Culicidae, Diptera) // Генетика. 2009. Т. 45,
№ 1. С. 59–63.
12. Kumar V., Cornel A.J., Mukabayire O. In situ hybridization to Anopheles polytene chromosomes // Molecular Biology of Insect Disease Vectors: A Methods Manual. London :
Chapman and Hall, 1997. P. 337–345.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
168
Г.Н. Артемов, Г.М. Абылкасымова, В.Н. Стегний
13. Lichter P., Ledbetter S.A., Ledbetter D.H., Ward D.C. Fluorescence in situ hybridization with
Alu and L1 polymerase chain reaction probes for rapid characterization of human chromosomes in hybrid cell lines // Proc. Nat. Acad. Sci. USA. 1990. Vol. 87, № 17. P. 6634–6638.
14. Стегний В.Н. Инверсионный полиморфизм малярийного комара Anopheles messeae.
IV. Стационарность частотного распределения инверсий по ареалу вида // Генетика.
1983. Т. 19, № 3. С. 466–473.
15. Стегний В.Н. Популяционная генетика и эволюция малярийных комаров. Томск :
Изд-во Томского ун-та, 1991. 137 с.
16. Стегний В.Н. Архитектоника генома, системные мутации и эволюция. Новосибирск :
Изд-во Новосиб. ун-та, 1993. 111 с.
17. Стегний В.Н. Генетические основы эволюции малярийных комаров. I: Хромосомные
филогенетические связи // Зоологический журнал. 1981. Т. 60, вып. 1. С. 69–77.
18. Артемов Г.Н., Стегний В.Н. Молекулярно-генетический анализ районов прикрепления хромосом к оболочке ядра трофоцитов яичников малярийных комаров Anopheles
комплекса «maculipennis» // Вестник Томского государственного университета. Биология. 2010. Т. 10, № 2. С. 123–131.
19. Grushko O.G., Sharakhova M.V., Stegnii V.N., Sharakhov I.V. Molecular organization of
heterochromatin in malaria mosquitoes of the Anopheles maculipennis subgroup // Gene.
2009. № 448. P. 192–197.
20. Шарахова М.В., Стегний В.Н., Тимофеева О.В. Полиморфизм прицентромерного гетерохроматина политенных хромосом трофоцитов яичников в природных популяциях малярийного комара Anopheles messeae Fall. // Генетика. 1997. Т. 33, № 2.
С. 281–283.
21. Girod P.A., Nguyen D.Q., Calabrese D. et al. Genome-wide prediction of matrix attachment
regions that increase gene expression in mammalian cells // Nat. Methods. 2007. Vol. 4,
№ 9. P. 747–753.
22. Avramova Z., Tikhonov A., Chen M., Bennetzen J.L. Matrix attachment regions and structural colinearity in the genomes of two grass species // Nucleic Acids Res. 1998. № 26.
P. 761–767.
Поступила в редакцию ­­­­­­­­­­­­­­­­­­­­­­­­­­03.08.2011 г.
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 157–169
Gleb N. Artemov 1,2, Gulnar M. Abilkasimova3, Vladimir N. Stegniy1, 2
1
Research Institute of Biology and Biophysics of Tomsk State University, Tomsk, Russia
2
Biological Institute of Tomsk State University, Tomsk, Russia
3
Institute of General Genetics and Cytology, Alma-Ata, Kazakhstan
MOLECULAR-CYTOGENETIC ANALYSIS OF CHROMOSOME
ATTACHMENT REGIONS TO NURSE CELLS NUCLEAR ENVELOPE
IN Anopheles MALARIA MOSQUITOES OF «maculipennis» SUBGROUP
The interphase nucleus spatial organization has been a current problem. Internucleus architecture is provided by interactions of chromosomes with nuclear envelope
and each other. Malaria mosquitoes are extremely useful for nucleus architecture investigation because their close related species differ by nurse cells chromosomes spatial
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Молекулярно-цитогенетический анализ района
169
organization. The goal of our research is comparative analysis of DNA of XL chromosome attachment region of Anopheles messeae Fall. and chromosomes attachment
regions sequence of «maculipennis» subgroup malaria mosquitoes (An. atroparvus
Thiel., An. beklemishevi Steg. et Kab., An. maculipennis Mg. и An. melanoon Hackett.).
XL chromosome An. messeae is connected with nuclear cover by region that is located
in the middle of the chromosome arm. The benefit of this work is researching a region
that is not pericentromeric. Therefore, the attachment region DNA analysis without
pericentromeric region sequences (per se) is possible. DNA from XL chromosome attachment region of An. messeae nurse cells was separated with the help of microdissection and subsequent DOP-PCR amplification. Fluorescent in situ hybridization of this
DNA with «maculipennis» subgroup malaria mosquitoes chromosomes revealed that
XL chromosome attachment region of An. messeae contains the sequences including
pericenromeric heterochromatin. We propose, decreasing the number of sites contained
DNA from XL chromosome attachment region of An. messeae during subgroup forming. Moreover, in An. maculipennis и An. messeae conservative sequences decreasing
in intercalary heterochromatin its accumulation can occur in chromosomes 2, 3R and
XL pericentric α-heterochromatin.
The sequences of XL chromosome attachment region of An. messeae and other mosquitoes chromosome regions with β-heterochromatin morphology, including chromosome without attachment regions, do not differ significantly. Probably, XL chromosome
attachment region of An. messeae consists of repeated sequences of different classes:
universal for heterochromatic regions and taking part in XL chromosome spatial organization. Homeiological to XL chromosome attachment region of An. messeae regions
are located in the middle of the chromosome arm in ancestral species and even nearctic specimen – An. beklemishevi always. Therefore, An. messeae XL chromosomes
with the attachment region in the middle of arm appearance are not connected with
chromosomes rearrangements (e.g. inversion) but could be initiated through the DNA
sequences reorganization. The transposition of transposable elements, containing SAR/
MAR sequences, is one of the ways to create new chromosome attachment regions to
nuclear envelope.
Key words: nucleus spatial organization; chromosome attachment regions to the
nucleus envelope; heterochromatin; malaria mosquitoes; Anopheles.
Received August 3, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 170–184
УДК 575.852.112:575.852.113:004.273
К.В. Гунбин1, М.А. Генаев1, И.И. Турнаев1, Д.А. Афонников1, 2
1
Институт цитологии и генетики СO РАН (г. Новосибирск)
Новосибирский государственный университет (г. Новосибирск)
2
КОМПЬЮТЕРНАЯ СИСТЕМА АНАЛИЗА
РЕЖИМОВ МОЛЕКУЛЯРНОЙ ЭВОЛЮЦИИ ГЕНОВ
И БЕЛКОВ: АНАЛИЗ ЭВОЛЮЦИИ ЦИКЛИНОВ B
Работа выполнена при финансовой поддержке РФФИ (грант № 09-04-01641-а),
а также в рамках интеграционных проектов СО РАН № 113, 119;
Министерства образования и науки РФ (ГК № П857, № 07.514.11.4003);
Программ РАН (№ 6.8, Б 26.29 и 24.2).
Создана интернет-доступная компьютерная система анализа режимов
молекулярной эволюции генов и белков (http://pixie.bionet.nsc.ru/samem/). Анализ
режимов эволюции производится на основе расчета отношения частот фиксации радикальных аминокислотных замен к консервативным, на основе впервые
предложенного нами метода анализа скоростей различных типов замен аминокислот в эволюции белков и на основе статистического соотнесения изменения
свойств аминокислот с фенотипическими признаками организмов. С помощью
созданной системы проведено исследование режимов молекулярной эволюции
циклинов В. Показано качественное отличие картин фиксации атипичных аминокислотных замен в эволюции циклинов В животных и грибов. Также показано,
что у животных эволюция циклинов B3, в отличие от циклинов B1 и B2, была
связана с усложнением организма.
Ключевые слова: молекулярная эволюция; консервативные и радикальные
аминокислотные замены; система «клиент-сервер»; статистический анализ;
циклины B.
Введение
В последнее время появилось огромное количество данных о существовании универсальной связи между уровнем экспрессии гена и скоростью
его эволюции [1–3]. В 2008 г. впервые было показано, что эта связь обусловлена отбором против неправильного сворачивания белков вследствие ошибок трансляции [2]. Также показано [2], что этот отбор может проявляться
в: 1) уменьшении числа ошибок трансляции, 2) уменьшении вероятности
неправильного сворачивания белка при ошибочной трансляции, 3) уменьшении вероятности неправильного сворачивания и денатурации белка. Очевидно, что давление отбора в результате ответа на процессы (2) и (3) связаны
с аминокислотными заменами, по-разному влияющими на структуру белка.
Структура белка, его функция и сворачивание определяются комбинацией
свойств аминокислот. Проанализировано более 500 свойств аминокислот
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Компьютерная система анализа режимов
171
[4], что позволяет проводить систематические исследования эволюции белок-кодирующих генов. Подходами, направленными на решение этой задачи, являются анализ отношения частот фиксации радикальных аминокислотных замен к консервативным (KR/KC) [5, 6] и исследование скоростей
изменения физико-химических свойств белков (VPC) в их эволюции [7]. Однако эти подходы обладают существенным недостатком – необходимо знать
заранее «адаптивность изменения» определенного свойства аминокислот.
Предложенный нами подход базируется на анализе KR/KC и VPC, но имеет два
отличия: 1) при анализе используются все известные свойства аминокислот; 2) проводится статистическое соотнесение изменения этих свойств с
фенотипическими признаками организмов, что позволяет напрямую связать
молекулярную эволюцию с приспособительной эволюцией организмов. На
этой основе нами была создана компьютерная система для анализа режимов
молекулярной эволюции генов и белков (http://pixie.bionet.nsc.ru/samem/).
В настоящей работе эта система использована для анализа эволюции циклинов B. Известно, что циклины B составляют древнее по происхождению
семейство белков, контролирующих центральную часть клеточного цикла –
вход в митоз [8, 9]. Важно отметить, что только эти циклины экспрессируются во всех тканях организма животных [8, 9]. В то же время детальный
анализ режимов молекулярной эволюции циклинов В до сих пор не проведен. Поэтому с целью тестирования возможностей созданной компьютерной
системы был проведен анализ эволюции циклинов B.
Материалы и методики исследования
Описание компьютерной системы
Система состоит из двух основных конвейеров, анализа эволюции генов
и анализа эволюции белков, и двух дополнительных, собирающих выборки
генов и белков и производящих их первичный анализ, построение матриц
BLOSUM. Основные конвейеры позволяют провести основные этапы обработки данных, комбинируя различные методы множественного выравнивания, построения филогенетического дерева и реконструкции предковых
последовательностей. Множественное выравнивание рассчитывается программами MAFFT 6.717 и KALIGN 2.04; филограмма (филогенетическое
дерево с неравными длинами ветвей от корня, отражающими скорости замен) – программами FASTTREE 2.1.1 и PHYML 3.0; филограмма преобразуется в хронограмму (филогенетическое дерево, построенное на основе
гипотезы релаксированных молекулярных часов) программой R8S 1.71. При
преобразовании филограммы в хронограмму используются датировки дивергенций, задаваемые пользователем. Предковые последовательности белков реконструируются на основе выравниваний, не содержащих делеции, с
помощью программ ANCESCON, FASTML (серверная версия) и CODEML
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
172
К.В. Гунбин, М.А. Генаев, И.И. Турнаев, Д.А. Афонников
(из пакета PAML 4.4); генов – ANC-GENE, FASTML (серверная версия) и
CODEML (из пакета PAML 4.4). Пользователь может рассчитать модель эволюции заданного семейства белков, используя MODELESTIMATOR 1.1, или
воспользоваться обобщенными моделями. Для анализа используются данные о 531 свойстве аминокислот [4].
Общий модуль оценки взаимосвязи эволюции свойств аминокислот и
фенотипических признаков реализован на языке R (пакет Ape) и реализует
3 группы статистических методов анализа данных [10] (GEE – Generalized
Estimating Equations, Lynch, или метод Variance Partitioning, и GLS –
Generalized Least Squares), принимающих во внимание филогенетическую
инерцию (наведенную хронограммой корреляцию [10]). Все использованные программы снабжены гиперссылками на соответствующий литературный источник, что позволяет пользователю своевременно знакомиться с методологической базой каждой используемой им программы. Для облегчения
работы пользователя для каждого вычислительного этапа компьютерной
системы имеются образцы вводимых данных.
Существенной особенностью конвейера анализа генов является возможность исследования разными методами оценки KR/KC. Пользователь может
воспользоваться как методами Жанга (программа HON-NEW) [5] и Смита
[6], так и улучшенным нами методом Смита. При анализе данных методами Жанга и Смита пользователь может задать число групп для разделения
20 аминокислот. Для каждого из 531 свойств аминокислоты группируются
методом K-средних (используя R). В улучшенном нами методе Смита [6]
для разбиения аминокислотных замен на консервативные и радикальные
используется информация из матрицы BLOSUM, строящейся для каждого
анализируемого семейства белков. Все неотрицательные (≥0) значения в матрице BLOSUM трактуются нами как консервативные, все отрицательные –
как радикальные.
Таким образом, в отличие от ранее предложенных подходов [5, 6], в которых радикальность и консервативность аминокислотных замен задается
исходя из группировки аминокислот по заранее заданным физико-химическим свойствам, нами используется более естественное разбиение аминокислотных замен, учитывающее структурную и функциональную природу
исследуемых белков. Важно отметить, что на отношение KR/KC существенно
влияют композиционные характеристики исследуемых генов, такие как частоты использования кодонов и отношение транзиций к трансверсиям [6].
Для сравнения наблюдаемых значений KR/KC со значениями KR/KC, свойственными эволюции генов при KA/KS=1, с помощью пакета INDELible 1.03
пользователем может быть проведено Марковское моделирование эволюции генов, учитывающее естественные частоты использования кодонов и
естественное отношение транзиций к трансверсиям. Следует отметить, что
в конвейере анализа эволюции генов также реализована возможность суммирования всех рассчитываемых величин (KR/KC, KC и KR).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Компьютерная система анализа режимов
173
При анализе последовательностей белков существенной особенностью
является впервые предложенный нами метод анализа скоростей фиксации
различных типов аминокислотных замен. Он основан на Марковском моделировании эволюции белков пакетом INDELible 1.03 и непараметрическом
перестановочном тесте, предложенном нами в работе [11]. INDELible 1.03
позволяет учесть детальные особенности эволюции белков (различие частот
встречаемости аминокислот и частот их замен у паралогичных групп внутри одного семейства белков вплоть до учета особенностей эволюции на
отдельных ветвях дерева). Тест с перестановками [11] позволяет выявить
для каждой ветви филогенетического дерева характерные типы аминокислотных замен (атипичные замены), частота которых статистически значимо
превышает частоту в смоделированных последовательностях.
Метод состоит из трех этапов анализа. На первом этапе на каждой ветви
дерева подсчитывается наблюдаемое количество (nreal(Type)) всех 190 типов
аминокислотных замен. Для внутренних ветвей это делается путем парного
сравнения последовательности-предка и последовательности-потомка, реконструированных программами CODEML, FASTML или ANCESCON. Для
конечных ветвей наблюдаемые числа всех типов аминокислотных замен
(nreal(Type)) подсчитываются путем парного сравнения последовательности
реконструированного предка и последовательности-потомка из современного организма. На втором этапе на каждой ветви дерева подсчитываются
ожидаемые количества всех типов замен на основе заданного пользователем количества компьютерных симуляций молекулярной эволюции белков.
Для этого анализируются более 1 000 модельных выравниваний, генерируемых программой INDELible 1.03 на основе заданных пользователем особенностей эволюции белков. На третьем этапе для каждой ветви дерева с
помощью перестановочного теста идет сравнение числа ожидаемых и наблюдаемых замен каждого из 190 типов. Множество наблюдаемых замен
при достаточном числе симуляций всегда входит во множество ожидаемых
замен.
Следовательно, путем случайной перестановки числа наблюдаемых замен внутри модельного набора замен можно сгенерировать заданное пользователем число (> 1 000) случайных выборок замен N, равных по объему выборкам наблюдаемых замен. Для каждой такой случайной выборки в тесте
оценивается число nrand(Type) аминокислотных замен определенного типа. Далее подсчитывается число случайных выборок M, в которых nrand(Type)>nreal(Type).
Величина M/N оценивает вероятность p, с которой встречаемость аминокислотных замен определенного типа, наблюдаемая в исходной выборке генов,
могла возникнуть по случайным причинам. Следует отметить, что в конвейере анализа эволюции белков также реализована возможность суммарного
анализа эволюционных изменений физико-химических свойств аминокислот. Для этого реализованы коррекции эволюционных расстояний Кимуры,
Джукса – Кантора и Гамма-коррекция.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
174
К.В. Гунбин, М.А. Генаев, И.И. Турнаев, Д.А. Афонников
Техническая основа компьютерной системы
Компьютерная система анализа режимов молекулярной эволюции генов и
белков создана на основе клиент-серверной конвейерной системы обработки
данных BioinfoWF. Серверная часть системы реализована в виде приложения
на языке Perl и отвечает за запуск и выполнение конвейера. На вход приложению подаются схема конвейера и описание вычислительных модулей. Схема конвейера, форматы данных и взаимодействие вычислительных модулей в
ней описываются на языке XML. Описание конвейера состоит из двух файлов.
Первый описывает вычислительные модули, второй задает топологию конвейера. Описание модулей состоит из следующих разделов: 1) входные файлы;
2) выходные файлы; 3) параметры и опции (идентификатор, описание, тип
параметра, значение по умолчанию, внешний вид поля запроса значения для
параметра на странице web-браузера); 4) правила генерации командной строки, 5) правила действия пользовательского интерфейса, позволяющие динамически изменять web-интерфейс модуля в процессе редактирования конвейера.
Второй файл задает топологию конвейера. В нем описываются имена входных /выходных файлов для каждого модуля и значения для каждого параметра
или опции. Приложение запускает конвейер, создавая файл с отчетом о статусе
выполнения каждого узла в формате XML. Серверная часть поддерживает параллельный запуск узлов конвейера и позволяет производить удаленный запуск ресурсоемких расчетных модулей на вычислительном кластере. Режим
запуска узла (локальный или удалённый) задается в схеме конвейера.
Клиентская часть реализована в виде web-приложения. Пользователю
предлагается работать с уже готовыми схемами. При этом доступны базовые
опции управления конвейером: 1) установка входных файлов, параметров и
опций для каждого вычислительного модуля в конвейере; 2) старт с произвольного узла и остановка на произвольном узле в конвейере; 3) отслеживание статуса выполнения каждого вычислительного модуля в конвейере;
4) просмотр входных/выходных файлов для каждого этапа расчета в конвейере; 5) привязка форматов входных/выходных файлов к различным приложениям для их визуализации. Генерация страниц в формате HTML реализована на Perl с использованием библиотеки HTML::Template. Дополнительно
используется JavaScript библиотека jQuery.
Материалы для тестирования компьютерной системы
В работе использовались 98 белковых последовательностей циклинов B
из полностью секвенированных геномов животных, грибов и простейших,
представленных в базе данных KEGG 52.0 [12]. Циклины – эволюционно
консервативная группа белков, поэтому дерево, построенное по молекулярным данным об их последовательностях, содержало полифуркации, что не
всегда позволяло достоверно установить порядок дивергенции некоторых
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Компьютерная система анализа режимов
175
таксонов. В этом случае порядок дивергенции разрешался вручную на основе анализа литературных данных и интернет-ресурса Tree of Life [13]. Для
определения порядка дивергенции одноклеточных предков многоклеточных
животных и грибов использовались полногеномные данные, полученные в работах [14–17]. Филогенетические отношения внутри таксона грибов разрешались также на основе полногеномных данных, полученных из работ [18, 19].
Для установления топологии дерева на уровне расхождения нематод, артропод и вторичноротых использовались данные, свидетельствующие в пользу
существования группы Ecdysozoa [20–27]. Для разрешения дерева на уровне
расхождения иглокожих, головохордовых, хордовых и оболочников использовались данные работ [22, 28–30]. Порядок расхождения организмов внутри
класса млекопитающих верифицировался по данным работ [31–35], внутри
группы артропод – по данным работы [36]. Порядок дивергенции паралогов
циклинов грибов, группы организмов, наиболее подверженной эффектам гетеротахии в эволюции [37], согласовывался с данными работы [38].
В настоящее время оценки числа клеточных типов, являющиеся устоявшейся мерой сложности эукариот, известны не для всех организмов, геномные данные которых были взяты нами для анализа. Однако ранее Вогелем и
Чотией был проведено исследование взаимосвязи между дупликациями генов
различных суперсемейств из базы данных Superfamily 1.69 с количеством клеточных типов для 38 видов эукариотических организмов [39]. Было выявлено
65 суперсемейств, из 1 221 у которых число генов семейства в геноме значимо (при r ≥ 0,9) коррелирует с числом клеточных типов организма (SCOP ID:
48726, 69179, 56854, 47986, 100895, 82671, 57440, 50353, 57196, 57535, 57552,
47090, 57581, 63763, 57501, 57667, 54511, 57256, 63748, 63501, 47769, 48092,
57610, 57302, 69687, 111418, 55550, 47031, 101494, 49842, 50923, 50370, 82708,
110035, 49299, 109775, 48670, 50044, 57586, 47686, 49265, 69318, 82895, 47391,
46966, 47655, 50729, 82615, 47719, 103359, 103637, 54919, 51045, 81783, 48305,
47454, 81419, 57190, 48097, 50242, 50814, 48619, 103575, 90188, 57603). Мы
предположили, что выявленные зависимости можно использовать и для оценки числа клеточных типов организмов, не представленных в выборке Вогеля
и Чотия. Поэтому в качестве параметра, характеризующего сложность организма, мы использовали десятичный логарифм суммы числа белков в этих суперсемействах (по данным базы Superfamily 1.73 [40]). Чем больше значение
этого параметра, тем выше сложность исследуемого организма.
После видового названия приведены идентификаторы последовательностей в базе KEGG. Оцененная при рассчете филогенетического дерева
достоверность ветвления показана числовыми значениями (критерий Шимодары и Хасегавы / критерий χ2). Бифуркации, разрешенные вручную на
основании литературных данных, показаны звездочкой, по эволюции циклинов грибов – решеткой. Жирным выделены ветви, на которых наблюдаются атипичные замены (p<0,01).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
176
К.В. Гунбин, М.А. Генаев, И.И. Турнаев, Д.А. Афонников
Результаты исследования и обсуждение
В целях тестирования возможностей компьютерной системы анализа
режимов молекулярной эволюции генов и белков, а также тестирования
разрешающей способности впервые предложенного нами метода анализа
скоростей фиксации различных типов аминокислотных замен был проведен
анализ эволюции циклинов B животных, грибов и простейших.
На первом этапе анализа мы провели поиск атипичных аминокислотных
замен на каждой ветви дерева циклинов B. Для поиска атипичных аминокислотных замен нами были использованы все три программы реконструкции
предковых последовательностей белков во внутренних узлах древа циклинов B (при реконструкции с помощью программы ANCESCON учитывалась
обобщенная WAG-модель относительных скоростей замен аминокислот; с
помощью FASTML – обобщенная LG-модель относительных скоростей замен аминокислот; с помощью CODEML – модель относительных скоростей
замен аминокислот для семейства циклинов B, созданная с использованием MODELESTIMATOR), установленные в созданную нами компьютерную
систему. На рис. 1 жирной линией показаны ветви, на которых были идентифицированы события атипичных аминокислотных замен с вероятностью
p < 0,01 при анализе данных всеми тремя методами реконструкции предков.
Рассматривая эволюцию циклинов B животных (рис. 1), можно отметить
важную закономерность: у позвоночных накопление атипичных аминокислотных замен, свидетельствующее об ускорении эволюции, идет преимущественно в ходе или после дупликаций паралогов. Одна из моделей эволюции
функций генов посредством их дупликации предполагает наличие нескольких функций у гена [41]. Очевидно, что после дупликации многофункционального гена эволюция разных функций гена-предка может идти самостоятельно в дуплицированных копиях гена [41], что увеличивает адаптивную
пластичность организма. Интересно, что именно такая картина свойственна
эволюции паралогичных групп циклинов B1 и B2 животных, что согласуется с отличиями функций циклинов B1 и B2 животных. Например, известно,
что циклин B1 является основным, а циклин B2 – второстепенным, так как
мышата с нуль-мутацией по циклину B1 не рождаются, а мышата с нульмутацией по циклину B2 рождаются практически нормальными [42]. Также
известно, что циклин B1 экспрессируется в интерфазе в двух фракциях: свободной цитоплазматической и связанной с мембраной, а циклин B2 экспрессируется только в мембрано-связанной форме, поэтому циклин B1 практически полностью компенсирует отсутствие циклина B2, но не наоборот [42].
Несколько иная картина свойственна эволюции циклинов B грибов (см.
рис. 1): повышение темпов накопления атипичных замен характерно только для одного из дуплицированных циклинов – сначала только для CLB5-6,
затем только для CLB1-2 и, наконец, для отдельной подгруппы циклинов
внутри паралогичной группы CDC13.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Компьютерная система анализа режимов
177
Giardia lamblia GL50803 3977
Leishmania major LmjF25.1470
0,64/0,89
Trypanosoma cruzi 506711.30
Neosartorya fischeri NFIA 104100
CDC13
Aspergillus nidulans AN3648.2
Botryotinia fuckeliana BC1G 03287
Sclerotinia sclerotiorum SS1G 06752
Magnaporthe grisea MGG 05646
Neurospora crassa NCU02758
0,87/0,99
Podospora anserina PODANSg2116
Fusarium graminearum FG01291.1
Schizosaccharomyces pombe SPBC582.03
#
Malassezia globosa MGL 2582
Cryptococcus neoformans CNJ00160
#
Kluyveromyces lactis KLLA0D15543g
Ashbya gossypii AGOS AAR099W
CLB1-2
Saccharomyces cerevisiae YGR108W
Vanderwaltozyma polyspora Kpol 1006p2
Debaryomyces hansenii DEHA0A02189g
Pichia stipitis PICST 81868
Candida albicans CaO19.1446
0,99/1,00
1,00/1,00
Saccharomyces cerevisiae YPR120C
Candida glabrata CAGL0D04642g
Vanderwaltozyma polyspora Kpol 359p1
1,00/1,00
CLB5-6
Kluyveromyces lactis KLLA0D15565g
Ashbya gossypii AGOS AAR100C
Debaryomyces hansenii DEHA0G25520g
Pichia stipitis PICST 82085
Candida albicans CaO19.7186
Kluyveromyces lactis KLLA0C16445g
Ashbya gossypii AGOS ADR068W
1,00/1,00
CLB3-4
Saccharomyces cerevisiae YDL155W
Vanderwaltozyma polyspora Kpol 461p10
Yarrowia lipolytica YALI0B19206g
Neosartorya fischeri NFIA 091410
Oryzias latipes 759
Tetraodon nigroviridis 8349
Danio rerio 368316
0,69/0,89
0,90/1,00
Monodelphis domestica 100019727
Mus musculus 12442
0,94/1,00
Rattus norvegicus 363088
Homo sapiens 9133
Canis familiaris 478324
Sus scrofa 100135668
Bos taurus 281668
Equus caballus 100054413
0,94/1,00
Gallus gallus 415400
0,80/0,95
Taeniopygia guttata 100225413
Xenopus laevis 397743
Macaca mulatta 699504
Homo sapiens 891
0,91/1,00
Rattus norvegicus 25203
0,89/1,00
Mus musculus 268697
Equus caballus 100050093
Bos taurus 327679
Canis familiaris 485338
0,92/0,99
Monodelphis domestica 100019387
1,00/1,00
Ornithorhynchus anatinus 100083344
Xenopus laevis 379888
B2
B1
Danio rerio 58025
Oryzias latipes 17132
Ciona intestinalis 100184393
**
Drosophila melanogaster Dmel CG3510
Culex quinquefasciatus CpipJ CPIJ010895
Aedes aegypti AaeL AAEL010094
Anopheles gambiae AgaP AGAP004962
Nasonia vitripennis 100122223
Apis mellifera 551783
Caenorhabditis elegans Y43E12A.1
Strongylocentrotus purpuratus 576779
Hydra magnipapillata 100204331
Nematostella vectensis NEMVE v1g126046
Monosiga brevicollis MONBRDRAF T 8459
Equus caballus 100063155
0,92/1,00
0,98/1,00
0,66/0,91
1,00/1,00
0,1
*
Homo sapiens 85417
Mus musculus 209091
Gallus gallus 396167
Tetraodon nigroviridis 34481
Fugu rubripes 171285
Oryzias latipes 10666
Danio rerio 767751
Ciona intestinalis 100184160
Branchiostoma floridae BRAFLDRAF T 113036
0,98/1,00
Drosophila melanogaster Dmel CG5814
Drosophila mojavensis Dmoj GI22195
0,85/0,94
Anopheles gambiae AgaP AGAP002478
0,97/1,00
Aedes aegypti AaeL AAEL009572
Culex quinquefasciatus CpipJ CPIJ014315
0,97/1,00
Tribolium castaneum 660418
Apis mellifera 413667
Nasonia vitripennis 100122822
Caenorhabditis elegans T06E6.2
Strongylocentrotus purpuratus 591240
*
Nematostella vectensis NEMVE v1g208415
Hydra magnipapillata 100203281
Trichoplax adhaerens TRIADDRAF T 56083
Entamoeba dispar EDI 279800
Dictyostelium discoideum DDB 0185035
Рис. 1. Филогенетическое дерево циклинов B
B3
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
178
К.В. Гунбин, М.А. Генаев, И.И. Турнаев, Д.А. Афонников
Согласно модели дупликаций С. Оно [43] за процессом дупликации гена,
осуществляющего одну функцию, следует движущий отбор в одной из копий
гена, что приводит к драматическому изменению ее функции. В подавляющем большинстве случаев одна из копий гена в конечном итоге утрачивает свою функцию за счет дегенеративных мутаций. Однако иногда обе копии гена сохраняются в результате случайного приобретения новой важной
функции одной из копий гена. Ранее было показано, что для дрожжей имеет
место повышенная селекция против дуплицированных копий генов; дуплицированные же копии генов, сохранившиеся в процессе эволюции, имеют
функцию, отличную от предковой [44]. Согласно данным, полученным в настоящей работе, этот вывод можно экстраполировать на эволюцию циклинов
B грибов, так как картина распределения атипичных замен на филогенетическом древе грибов соответствует модели неофункционализации С. Оно.
Анализируя данные, представленные на рис. 1, также можно отметить иные,
таксон-специфические события накопления атипичных аминокислотных замен. Например, в циклине B3 у беспозвоночных ускорение темпов фиксации
атипичных замен выявлено на этапе возникновения двукрылых и перепончатокрылых насекомых, у позвоночных – на этапе возникновения млекопитающих.
Следует отметить, что циклины B3 в большей степени важны для контроля
мейоза, чем митоза [45–48]. У мышей и нематод, мутантных по циклину B3,
наблюдаются нарушения в дифференцировке половых клеток [45–48]. Следовательно, можно предположить, что на этапах возникновения двукрылых и
перепончатокрылых насекомых, а также при возникновении млекопитающих
происходят существенные изменения в контроле мейоза циклинами B3. Также
интересно отметить, что атипичные замены аминокислот в циклине B характерны для эволюции на этапе образования кишечнополостных.
На втором этапе мы проанализировали статистическую взаимосвязь
между изменением последовательности циклинов и изменением в ходе эволюции важного фенотипического признака организмов – сложности (см.
Материалы и методики). Изменения циклинов измерялись по изменению
физико-химических свойств аминокислот в белке в течение эволюции от
белка общего предка всех циклинов В до современного белка. Для преобразования филограммы циклинов B (см. рис. 1) в хронограмму использовались 19 палеонтологических границ варьирования датировок дивергенций
родов [49–53] (табл. 1).
Для ответа на вопрос, существует ли связь между изменением сложности
организмов и эволюцией циклинов, нами был проведен анализ взаимосвязи
между эволюционными изменениями свойств аминокислот в трех филетических группах циклинов B (циклины B3 животных, циклины грибов и циклины B1-2 животных) и изменением сложности организмов. Статистический анализ проводился группой методов GLS.
В ходе статистического анализа было выявлено, что с изменением сложности организмов статистически высокозначимо (p < 0,01) коррелировали
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Компьютерная система анализа режимов
179
изменения ряда физико-химических свойств аминокислот только в группе
циклинов B3 (табл. 2).
Границы варьирования датировок дивергенций родов
Дивергенция
Apis – Drosophila
Drosophila – Culex
Homo – Мacaca
Mus – Rattus
Homo – Mus
Homo – Bos
Bos – Canis
Ornithorhynchus – Homo
Taeniopygia – Gallus
Gallus – Homo
Время
дивергенции,
млн лет назад
max
min
307,2
238,5
295,4
238,5
33,9
23,0
12,3
11
100,5
61,7
113
71,2
71,2
62,2
191,1
162,5
86,5
66
330,4
312,3
Таблица 1
Время
дивергенции,
Дивергенция
млн лет назад
max
min
Oryzias – Fugu
150,9 96,9
Danio – Fugu
165,2 149,85
Danio – Gallus
421,75 416
Xenopus – Gallus
350,1 330,4
Drosophila – Homo
649
531,5
Hydra – Drosophila
712
615
Fusarium – Magnaporthe
500
400
Fusarium – Aspergillus
600
400
Saccharomyces – Candida
350
150
Таблица2
Физико-химические свойства аминокислот циклинов B3,
изменение которых коррелирует со сложностью организмов (p < 0,01)
Название физико-химического свойства
Группа физико-химического
свойства по данным [4]
Нормализованные параметры гибкости B-величин
для каждого остатка, окруженного двумя жесткими
соседями [54]
Гидрофильность и формирование
Нормализованные параметры гибкости B-величин поверхностных участков белка
для каждого остатка, окруженного одним жестким
соседом [54]
Формирование
Частота 4-го остатка в повороте [55]
неструктурированных участков
белка
Высокозначимая корреляция между изменением сложности организмов и изменением физико-химических свойств не наблюдалась в филетических группах циклинов B1-2 животных и циклинов грибов. В семействе
циклинов B3 скоррелированно со сложностью организмов в ходе эволюции изменялись свойства аминокислот, относящиеся к двум группам (см.
табл. 1) – группам физико-химических свойств, связанных с гидрофильностью и формированием поверхностных неструктурированных участков белков (петлевые структуры, переходные участки между петлями и β-слоями и
α-спиралями).
Иначе говоря, эволюционные изменения свойств аминокислот у циклинов B3, скоррелированные с изменением сложности организмов, указывают
на то, что связанная с изменением сложности организмов эволюция этих
циклинов происходила преимущественно по неструктурированным, поверхностным участкам белков. В то же время известно, что циклины осуществляют свою функцию опосредованно, за счет белок-белковых взаимо-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
180
К.В. Гунбин, М.А. Генаев, И.И. Турнаев, Д.А. Афонников
действий [8]. Таким образом, по-видимому, в процессе эволюции сложности
организмов происходили скоррелированные изменения в числе и природе
белок-белковых взаимодействий циклинов B3, играющих существенную
роль в контроле мейоза.
Почему с изменением сложности организмов высокозначимо коррелировали изменения физико-химических свойств аминокислот только в группе
циклинов B3? У большинства животных, за исключением наиболее простых, известно четыре семейства основных циклинов – A, B, D и E, контролирующих различные фазы клеточного цикла [8]. Циклин D контролирует
фазу G1, сильно варьирующую по длительности в разных клеточных типах; циклин E контролирует конец фазы G1 и также сильно варьирующий
по длительности переход G1/S; циклин A контролирует выход из S-фазы и
наиболее консервативную часть клеточного цикла – переход G2/M; циклин
B1-2 контролирует только самую консервативную часть клеточного цикла – переход G2/M [8]. Возможно, именно поэтому молекулярная эволюция
циклинов B1-2 животных не согласуется с эволюцией сложности животных.
У грибов из четырех семейств основных циклинов, характерных для животных, в геномах представлены только циклины типа B. У S. pombe есть
только одно семейство этих основных циклинов – cdc13. Показано, что cdc13
способен в одиночку обеспечивать прохождение клетки через все фазы клеточного цикла [56]. У других грибов, например S. cerevisiae, есть несколько
циклинов семейства B: clb1-2, clb3-4, clb5-6, которые контролируют различные фазы клеточного цикла (clb5-6 – S фазу, clb1-2, clb3-4 – G2 и M-фазы)
[57]. Такое различие по числу представленных в геномах грибов циклинов
B, а также отсутствие корреляции между изменением сложности и эволюцией циклинов могут быть связаны с мицелиальной организацией тела грибов,
когда процесс эволюционного усложнения организации сводится в первую
очередь к изменениям в биохимических путях, и только частично – к изменению формы гифа и нарушению синхронности деления ядер в гифе [58].
Заключение
Создана компьютерная система анализа режимов эволюции генов и белков. В основе системы лежат Марковское моделирование эволюции генов
и белков и анализ изменения всех известных физико-химических свойств
аминокислот. Уникальной особенностью системы является возможность напрямую соотносить вычисленные особенности молекулярной эволюции с
эволюцией заданных фенотипических признаков организмов и, таким образом, легко интерпретировать результат.
С помощью созданной системы проведено исследование режимов молекулярной эволюции циклинов В. Показано, что фиксация атипичных аминокислотных замен идет после дупликации у обоих паралогов B1 и В2 циклинов позвоночных, а также только в одной из дуплицированных копий в ряду
последовательных дупликаций в ходе молекулярной эволюции циклинов B
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Компьютерная система анализа режимов
181
грибов. В результате корреляционного анализа показано, что у животных
эволюция подсемейства циклинов B3, в отличие от подсемейств циклинов
B1 и B2, была связана с усложнением организма, что может быть объяснено
важной ролью циклинов B3 в контроле мейоза, а следовательно, и в контроле репродуктивной изоляции видов.
Литература
1. Drummond D.A., Bloom J.D., Adami C. et al. Why highly expressed proteins evolve slowly //
Proc. Natl. Acad. Sci. U.S.A. 2005. Vol. 102, № 40. P. 14338–14343.
2. Drummond D.A., Wilke C.O. Mistranslation-induced protein misfolding as a dominant
constraint on coding-sequence evolution // Cell. 2008. Vol. 134, № 2. P. 341–352.
3. Gout J.F., Kahn D., Duret L. Paramecium Post-Genomics Consortium. The relationship
among gene expression, the evolution of gene dosage, and the rate of protein evolution //
PLoS Genet. 2010. Vol. 6, № 5. P. e1000944.
4. Kawashima S., Pokarowski P., Pokarowska M. et al. AAindex: amino acid index database,
progress report 2008 // Nucleic Acids Res. 2008. Vol. 36, Database issue. P. D202–D205.
5. Zhang J. Rates of conservative and radical nonsynonymous nucleotide substitutions in
mammalian nuclear genes // J. Mol. Evol. 2000. Vol. 50, № 1. P. 56–68.
6. Smith Nick GC. Are radical and conservative substitution rates useful statistics in molecular
evolution? // J. Mol. Evol. 2003. Vol. 57, № 4. P. 467–478.
7. Pupko T., Sharan R., Hasegawa M. et al. Detecting excess radical replacements in phylogenetic
trees // Gene. 2003. Vol. 319, P. 127–135.
8. Cell Cycle Regulation / ed. by Р. Kaldis. Berlin : Springer-Verlag, 2006. 374 p.
9. Nieduszynski C.A., Murray J., Carrington M. Whole-genome analysis of animal A- and
B-type cyclins // Genome Biol. 2002. Vol. 3, № 12. P. RESEARCH0070.
10. Analysis of Phylogenetics and Evolution with R / ed. by Е. Paradis. N.Y. : Springer
Science+Business Media, 2006. P. 133–183.
11. Gunbin K.V., Afonnikov D.A., Kolchanov N.A. Molecular evolution of the hyperthermophilic
archaea of the Pyrococcus genus: analysis of adaptation to different environmental
conditions // BMC Genomics. 2009. Vol. 10. P. 639.
12. Kanehisa M., Goto S., Furumichi M. et al. KEGG for representation and analysis of
molecular networks involving diseases and drugs // Nucleic Acids Res. 2010. Vol. 38,
Database issue. P. D355–D360.
13. Maddison D.R., Schulz K.-S. (eds.) 2007. The Tree of Life Web Project. URL: http://tolweb.org
14. Burki F., Shalchian-Tabrizi K., Minge M. et al. Phylogenomics reshuffles the eukaryotic
supergroups // PLoS One. 2007. Vol. 2, № 8. P. e790.
15. Yoon H.S., Grant J., Tekle Y.I. et al. Broadly sampled multigene trees of eukaryotes // BMC
Evol. Biol. 2008. Vol. 8. P. 14.
16. Hampl V., Hug L., Leigh J.W. et al. Phylogenomic analyses support the monophyly of
Excavata and resolve relationships among eukaryotic «supergroups» // Proc. Natl. Acad.
Sci. U.S.A. 2009. Vol. 106, № 10. P. 3859–3864.
17. Minge M.A., Silberman J.D., Orr R.J. et al. Evolutionary position of breviate amoebae and
the primary eukaryote divergence // Proc. Biol. Sci. 2009. Vol. 276, № 1657. P. 597–604.
18. Fitzpatrick D.A., Logue M.E., Stajich J.E., Butler G. A fungal phylogeny based on
42 complete genomes derived from supertree and combined gene analysis // BMC Evol.
Biol. 2006. Vol. 6. P. 99.
19. Wang H., Xu Z., Gao L., Hao B. A fungal phylogeny based on 82 complete genomes using
the composition vector method // BMC Evol. Biol. 2009. Vol. 9. P. 195.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
182
К.В. Гунбин, М.А. Генаев, И.И. Турнаев, Д.А. Афонников
20. Dopazo H., Dopazo J. Genome-scale evidence of the nematode-arthropod clade // Genome
Biol. 2005. Vol. 6, № 5. P. R41.
21. Irimia M., Maeso I., Penny D. et al. Rare coding sequence changes are consistent with
Ecdysozoa, not Coelomata // Mol. Biol. Evol. 2007. Vol. 24, № 8. P. 1604–1607.
22. Philippe H., Brinkmann H., Martinez P. et al. Acoel flatworms are not platyhelminthes:
evidence from phylogenomics // PLoS One. 2007. Vol. 2, № 1. P. e717.
23. Lartillot N., Philippe H. Improvement of molecular phylogenetic inference and the
phylogeny of Bilateria // Philos. Trans. R. Soc. Lond. B Biol. Sci. 2008. Vol. 363, № 1496.
P. 1463–1472.
24. Marletaz F., Le Parco Y. Careful with understudied phyla: the case of chaetognath // BMC
Evol. Biol. 2008. Vol. 8. P. 251.
25. Helmkampf M., Bruchhaus I., Hausdorf B. Phylogenomic analyses of lophophorates
(brachiopods, phoronids and bryozoans) confirm the Lophotrochozoa concept // Proc. Biol.
Sci. 2008. Vol. 275, № 1645. P. 1927–1933.
26. Roy S.W., Irimia M. Rare genomic characters do not support Coelomata: intron loss/gain //
Mol. Biol. Evol. 2008. Vol. 25, № 4. P. 620–623.
27. Podsiadlowski L., Braband A., Struck T.H. et al. Phylogeny and mitochondrial gene order
variation in Lophotrochozoa in the light of new mitogenomic data from Nemertea // BMC
Genomics. 2009. Vol. 10. P. 364.
28. Holland L.Z., Albalat R., Azumi K. et al. The amphioxus genome illuminates vertebrate
origins and cephalochordate biology // Genome Res. 2008. Vol. 18, № 7. P. 1100–1111.
29. Swalla B.J., Smith A.B. Deciphering deuterostome phylogeny: molecular, morphological
and palaeontological perspectives // Philos. Trans. R. Soc. Lond. B Biol. Sci. 2008. Vol. 363,
№ 1496. P. 1557–1568.
30. Singh T.R., Tsagkogeorga G., Delsuc F. et al. Tunicate mitogenomics and phylogenetics:
peculiarities of the Herdmania momus mitochondrial genome and support for the new
chordate phylogeny // BMC Genomics. 2009. Vol. 10. P. 534.
31. Hallstrom B.M., Kullberg M., Nilsson M.A., Janke A. Phylogenomic data analyses provide
evidence that Xenarthra and Afrotheria are sister groups // Mol. Biol. Evol. 2007. Vol. 24,
№ 9. P. 2059–2068.
32. Kitazoe Y., Kishino H., Waddell P.J. et al. Robust time estimation reconciles views of the
antiquity of placental mammals // PLoS One. 2007. Vol. 2, № 4. P. e384.
33. Kjer K.M., Honeycutt R.L. Site specific rates of mitochondrial genomes and the phylogeny
of eutheria // BMC Evol. Biol. 2007. Vol. 7. P. 8.
34. Murphy W.J., Pringle T.H., Crider T.A. et al. Using genomic data to unravel the root of the
placental mammal phylogeny // Genome Res. 2007. Vol. 17, № 4. P. 413–421.
35. Hou Z.C., Romero R., Wildman D.E. Phylogeny of the Ferungulata (Mammalia:
Laurasiatheria) as determined from phylogenomic data // Mol. Phylogenet. Evol. 2009.
Vol. 52, № 3. P. 660–664.
36. Krauss V., Thummler C., Georgi F. et al. Near intron positions are reliable phylogenetic
markers: an application to holometabolous insects // Mol. Biol. Evol. 2008. Vol. 25, № 5.
P. 821–830.
37. Kolaczkowski B., Thornton J.W. A mixed branch length model of heterotachy improves
phylogenetic accuracy // Mol. Biol. Evol. 2008. Vol. 25, № 6. P. 1054–1066.
38. Archambault V., Buchler N.E., Wilmes G.M. et al. Two-faced cyclins with eyes on the targets
// Cell Cycle. 2005. Vol. 4, № 1. P. 125–130.
39. Vogel C., Chothia C. Protein Family Expansions and Biological Complexity // PLoS
Comput. Biol. 2006. Vol. 2, № 5. P. e48.
40. Wilson D., Pethica R., Zhou Y. et al. SUPERFAMILY – Comparative Genomics, Datamining
and Sophisticated Visualisation // Nucleic Acids Res. 2009. Vol. 37, Database issue.
P. D380–D386.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Компьютерная система анализа режимов
183
41. Hughes A.L. The evolution of functionally novel proteins after gene duplication // Proc. R.
Soc. Lond. Ser. B Biol. Sci. 1994. Vol. 256, № 1346. P. 119–124.
42. Brandeis M., Rosewell I., Carrington M. et al. Cyclin B2-null mice develop normally and
are fertile whereas cyclin B1-null mice die in utero // Proc. Natl. Acad. Sci. U.S.A. 1998.
Vol. 95, № 8. P. 4344–4349.
43. Оно С. Генетические механизмы прогрессивной эволюции. М. : Мир, 1973. 227 с.
44. Teichmann S.A., Babu M.M. Gene regulatory network growth by duplication // Nat. Genet.
2004. Vol. 36, № 5. P. 492–496.
45. van der Voet M., Lorson M.A., Srinivasan D.G. et al. C. elegans mitotic cyclins have distinct
as well as overlapping functions in chromosome segregation // Cell Cycle. 2009. Vol. 8,
№ 4. P. 4091–4102.
46. Miles D.C., van den Bergen J.A., Sinclair A.H., Western P.S. Regulation of the female mouse
germ cell cycle during entry into meiosis // Cell Cycle. 2010. Vol. 9, № 2. P. 408–418.
47. Nguyen T.B., Manova K., Capodieci P. et al. Characterization and expression of mammalian
cyclin b3, a prepachytene meiotic cyclin // J. Biol. Chem. 2002. Vol. 277, № 44. P. 41960–
41969.
48. Refik-Rogers J., Manova K., Koff A. Misexpression of cyclin B3 leads to aberrant
spermatogenesis // Cell Cycle. 2006. Vol. 5, № 17. P. 1966–1973.
49. Benton M.J., Donoghue P.C. Paleontological evidence to date the tree of life // Mol. Biol.
Evol. 2007. Vol. 24, № 1. P. 26–53.
50. Peterson K.J., Cotton J.A., Gehling J.G., Pisani D. The Ediacaran emergence of bilaterians:
congruence between the genetic and the geological fossil records // Philos. Trans. R. Soc.
Lond. B Biol. Sci. 2008. Vol. 363, № 1496. P. 1435–1443.
51. Budd G.E. The earliest fossil record of the animals and its significance // Philos. Trans. R.
Soc. Lond. B Biol. Sci. 2008. Vol. 363, № 1496. P. 1425–1434.
52. Taylor J.W., Berbee M.L. Dating divergences in the Fungal Tree of Life: review and new
analyses // Mycologia. 2006. Vol. 98, № 6. P. 838–849.
53. Berbee M.L., Taylor J.W. Dating the molecular clock in fungi – how close are we? // Fungal
Biol. Rev. 2010. Vol. 24, № 1–2. P. 1–16.
54. Vihinen M., Torkkila E., Riikonen P. Accuracy of protein flexibility predictions // Proteins.
1994. Vol. 19, № 2. P. 141–149.
55. Chou P.Y., Fasman G.D. Prediction of the secondary structure of proteins from their amino
acid sequence // Adv. Enzymol. 1978. Vol. 47. P. 45–148.
56. Fisher D.L., Nurse P. A single fission yeast mitotic cyclin B p34cdc2 kinase promotes both
S-phase and mitosis in the absence of G1 cyclins // EMBO J. 1996. Vol. 15, № 4. P. 850–860.
57. Bloom J., Cross F.R. Multiple levels of cyclin specificity in cell-cycle control // Nat. Rev.
Mol. Cell Biol. 2007. Vol. 8, № 2. P. 149–160.
58. Мюллер Э., Леффлер В. Микология. М. : Мир, 1995. 343 с.
Поступила в редакцию 03.12.2010 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
184
К.В. Гунбин, М.А. Генаев, И.И. Турнаев, Д.А. Афонников
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 170–184
Konstantin V. Gunbin1, Mikhail A. Genaev1, Igor I. Turnaev1, Dmitry A. Afonnikov1, 2
Institute of Cytology and Genetics of Siberian Branch
of Russian Academy of Sciences, Novosibirsk, Russia
2
Novosibirsk State University, Novosibirsk, Russia
1
COMPUTER SYSTEM FOR ANALYSIS OF MOLECULAR
EVOLUTION MODES OF GENES AND PROTEINS: A CASE
STUDY OF THE CYCLIN B MOLECULAR EVOLUTION
The evolution of protein-coding genes is characterized by two types of single-nucleotide
substitutions: non-synonymous, altering protein structure, and synonymous, that does
not change the protein. Natural selection of proteins is manifested through various nonsynonymous fixations. Protein function, structure and folding are all determined by the
combination of physicochemical properties of amino acids. To analyze the protein evolution
mode two main approaches were previously introduced: (1) based on the calculation of the
radical (large changes in certain physicochemical property) to conservative (small changes
in certain physicochemical property) codon substitutions rate ratio (KR/KC), and (2) based
on analysis of variance of rate changes of various physicochemical amino acid properties
(VPC) in the course of protein evolution. The essential drawback of these approaches is the
need to know in advance “positive change” of certain amino acid properties.
Our novel computer system for protein evolution mode analysis is also based on the
KR/KC and VPC, but has two crucial differences which allow us to overcome the drawback:
(1) we take into account all the known properties of amino acids, and (2) we calculate
the statistical relation of properties changes with certain adaptive phenotypical features of
organisms. The opportunity to match evolutionary change of all amino acid properties with
positively selected phenotypical features of organisms permits direct attribution of certain
protein changes to selection events. On this basis, a computer system for analyzing of
molecular evolution mode of genes and proteins was developed (http://pixie.bionet.nsc.ru/
samem/). Our computer system consists of two main pipelines, analyzing the evolutionary
modes of genes (I) and proteins (II), and two supplementary pipelines, collecting a sample
of genes and proteins (III) and producing their primary analysis (IV). An essential feature
of the gene analysis pipeline is a possibility to study gene evolution modes using different
KR/KC calculation methods. Pipeline for protein analysis implements a novel algorithm for
detection of atypical amino acids fixations on phylogenetic tree branches. This algorithm is
based on Markov simulation of protein sequence evolution, and uses the permutation test
for comparison of the simulated protein molecular evolution with real one.
To test the capabilities of our computer system and performance of our novel algorithm
for detection of atypical amino acids fixations on tree branches the molecular evolution of
cyclin B protein family was analyzed. It was shown that the fixation of atypical amino acid
substitutions is frequent to both cyclin paralogs B1 and B2 after cyclin B duplication in the
vertebrate evolution. In contrast, only one of the duplicated cyclin B copies possessed of
atypical amino acid fixations in a series of successive cyclin B duplications in the fungal
evolution. Moreover, it was shown that the evolution of cyclins B3 subfamily, in contrast
with cyclin B1 and B2 subfamilies, was strictly associated with increasing of animal’s
complexity. This association can be explained by the important role of cyclin B3 in the
meiosis and, hence, in the mechanisms of reproductive isolation.
Key words: molecular evolution; conservative and radical amino acid substitutions;
client-server system; statistical analysis; cyclin B.
Received December 3, 2010
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 185–196
РЕЦЕНЗИИ, КРИТИКА, БИБЛИОГРАФИЯ
УДК 581.524+581.55(571.1)
Г.С. Таран
Западно-Сибирский филиал Института леса им. В.Н. Сукачева
СО РАН (г. Новосибирск)
Г.Д. ДЫМИНА. КЛАССИФИКАЦИЯ, ДИНАМИКА И ОНТОГЕНЕЗ
ФИТОЦЕНОЗОВ (НА ПРИМЕРЕ РЕГИОНОВ СИБИРИ)
(НОВОСИБИРСК : ИЗД-ВО НГПУ, 2010. 213 с.)*
Рецензируемая монография подводит итог работам Г.Д. Дыминой в Западной Сибири. Она состоит из 7 глав, включающих 46 таблиц и 30 рисунков, и
списка литературы (625 источников, в том числе 73 – на иностранных языках).
В главе 1 «Общая характеристика работы» прослеживается история эколого-флористической классификации в Западной Сибири, характеризуются
методика и объем материала. Как сообщает автор, в основу работы легли
1 500 геоботанических описаний (далее – оп.), выполненных Г.Д. Дыминой
(далее – Г.Д.) в 1980–1987 гг., и около 200 описаний других авторов. В книге
приведено 180 описаний.
В главе 2 «Растительность юга Западной Сибири (правобережье Оби
в пределах Новосибирской области)» описана растительность 4 ключевых участков. На них выявлена 21 ассоциация (далее – асс.) из 3 классов:
Molinio-Arrhenatheretea (8 асс.), Festuco-Brometea (10), Querco-Fagetea
(3); 3 субассоциации (далее – субасс.) описаны как новые. Ряд синтаксонов
(луга – 4 асс. и 1 сообщество; степи – 2 асс.) характеризуется таблицами,
включающими 63 оп. В табл. 2.17 приведены диагнозы 3 асс. березовых и
осиновых травяных лесов. Эти леса отнесены в класс Querco-Fagetea, что
неверно: их место в классе Brachypodio pinnati–Betuletea pendulae [1].
В главе 3 «Растительность поймы Средней Оби (север Томской области)»
помещен продромус травяных сообществ, включающий 12 асс. из 4 классов:
Potametea (2), Phragmito-Magnocaricetea (8), Molinio-Arrhenatheretea (1),
Scheuchzerio-Caricetea fuscae (1). Также описываются 8 новых субасс. Все
синтаксоны поясняются в таблицах.
Предлагаемые Г.Д. синтаксономические решения имеют тот же вид, что
и в диссертации, защищенной более 20 лет назад [2], а потому во многих
случаях устарели либо изначально были неверны. Так, в таблице 3.3 к асс.
Equisetetum fluviatilis Steffen 1931 отнесено оп. 7 с доминированием Carex
* Предлагаемая вниманию читателя рецензия, написанная убедительно и жестко, носит явно
дискуссионный характер, но редакция считает возможным опубликовать ее на страницах
журнала.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
186
Г.С. Таран
vesicaria и оп. 8 с доминированием Hippuris vulgaris. Таким образом, Г.Д.
ложно трактует объем данного синтаксона. В оригинальном диагнозе асс.
Equisetetum fluviatilis [3. С. 122] хвощ приречный доминирует с 4–5 баллами
проективного покрытия, а ПП сопутствующих видов не превышает 3 баллов.
В табл. 3.4 характеризуется асс. Rorippo amphibiae–Equisetetum arvensis
Dymina et Ershova 2008 [4]. Она невалидна как nomen superfluum [5: Art. 18b,
29c], поскольку объединяет ценозы, уже выделенные в асс. Eleocharitetum
palustris Ubriszy 1948, Rorippetum amphibiae Pass. 1964, Agrostio stoloniferae–Equisetetum arvensis (Prokopjev 1990) Grigorjev ex Taran 1995.
Предлагая объединение ценозов Equisetum arvense и Rorippa amphibia в одну
ассоциацию, Г.Д. Дымина ссылается на экологические шкалы Л.Г. Раменского
[6], утверждая, что оптимумы этих видов по увлажнению и минерализации почвы «в основном совпадают» (с. 64). На самом деле при проективном покрытии
более 8% экологические амплитуды Equisetum arvense и Rorippa amphibia по
фактору увлажнения разнесены на 27 ступеней (61–68-я и 95–98-я ступени соответственно). Второй довод – пример микропоясных рядов на берегу небольшого залива (рис. 3.1), состоящих из полос Equisetum arvense, Rorippa amphibia
и Eleocharis palustris, которые комбинируются различным образом. Отсутствие
четкой закономерности в чередовании микропоясов отмельных видов «…подтверждает случайность и эфемерность их доминирования и нецелесообразность выделения по ним разных ассоциаций. <...> Для единиц подобного рода
во флористической классификации логичнее выделять крупные ассоциации, а
внутри них – доминантные варианты или доминантные фации» (с. 65).
Флористическое сходство характерно для многих сообществ класса
Phragmito-Magnocaricetea. W. Koch [7], указывая на неоднозначный характер микропоясности по берегам водоемов, дискутировал с авторами, признающими монодоминантные ассоциации, предлагая ассоциацию крупного объема: Scirpo-Phragmitetum W. Koch 1926. В ней различались фации
schoenoplectosum, phragmitosum, phalaridosum, glyceriosum aquaticae,
typhosum, typicum (полидоминантная). Перечисленные монодоминантные
фации ныне принимаются в качестве самостоятельных ассоциаций. Точно
так же нецелесообразно, наблюдая экотонные отмельные сообщества, объединять в одну асс. Rorippo amphibiae–Equisetetum arvensis монодоминантные ценозы хвоща, жерушника и болотницы.
Асс. Carici acutae–Comaretum Schelyag-Sosonko et al. 1986 (табл. 3.9)
следует относить к субасс. Caricetum gracilis comaretosum palustris
Blažkova 1971 [8], асс. Carici acutae–Phalaroidetum (табл. 3.10) – к Phalaridetum arundinaceae Libbert 1931 вар. Carex acuta [9]. Обские вейниковые
(Calamagrostis purpurea) луга (табл. 3.11) неверно отождествлять с асс. Calamagrostio langsdorffii–Phalaroidetum Turubanova et al. 1986, которая включена в класс Molinio-Arrhenatheretea [10]. Их место в асс. Calamagrostietum
purpureae Taran 1995 или субасс. Phalaridetum arundinaceae calamagrostietosum purpureae Taran 1995 [11, 12].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Г.Д. Дымина. Классификация, динамика и онтогенез
187
Асс. Anemonidio dichotomi–Phalaroidetum arundinaceae (табл. 3.14–
3.16) разделена на субасс. A. d.–Ph. a. calamagrostietosum, A. d.–Ph. a. caricetosum cespitosae и A. d.–Ph. a. alismatetosum plantagini-aquaticae, которые
даются как новые. Тем самым игнорируется принцип приоритета [5: Principle IV], поскольку ассоциация уже валидизирована как Anemonidio dichotomi–Phalaroidetum arundinaceae Mirkin ex Taran 1995 с субасс. A. d.–Ph. a.
poetosum palustris Denisova ex Taran 1995 и A. d.–Ph. a. sanguisorbetosum
officinalis Taran 1995 [11]. При этом табл. 3.15 содержит голотип субасс.
A. d.–Ph. a. sanguisorbetosum officinalis (оп. 7), а табл. 3.16 – голотип асс. Senecioni tatarici–Sanguisorbetum officinalis Taran 1995 (оп. 7). Все 3 субасс.,
описанные Г.Д., невалидны как nomina superflua [5: Art. 18b, 18c, 29c].
Ситуация с Carici rostratae–Comaretum Dymina 2010 ass. prov. (табл. 3.17)
не менее пикантна. Под таблицей указано, что автор оп. 1, 2, 6 – Г.Д., автор
оп. 3–5 – я. На самом деле я являюсь автором оп. 3, 4, 6; автор оп. 1, 2, 5 –
И. Пупик. Оп. 3–6 опубликованы [11]. Оп. 6 – голотип субасс. Calletum palustris galietosum ruprechtii Taran 1995 [11: табл. 3, оп. 9]; оп. 3 относится к ней же
[11: табл. 3, оп. 7], оп. 5 – к субасс. Caricetum juncellae spiraeetosum salicifoliae Taran 1995 [11: табл. 9, оп. 8], оп. 4 – к субасс. Carici aquatilis–Comaretum
palustris stellarietosum palustris Taran 1995 [11: табл. 7, оп. 9]. Оп. 1–2 также
входят в состав последней. Все 6 оп. (табл. 3.17) относятся к классу PhragmitoMagnocaricetea, а не Scheuchzerio–Caricetea fuscae, как полагает Г.Д.
В главе 3 приводится 117 оп., которые за исключением 10 оп.-голотипов
приводятся без автора, полевого номера, даты, локалитета, что отчасти обесценивает приводимый материал. Авторство установлено мною по черновикам валовых таблиц: 39 оп. выполнил я, 19 оп. – студентка И. Пупик, которая
не упоминается в книге. Из 39 моих описаний 28 опубликованы [11, 13], в
том числе голотипы асс. Senecioni tatarici–Sanguisorbetum officinalis и субасс. Anemonidio dichotomi–Phalaroidetum arundinaceae sanguisorbetosum
officinalis и Calletum palustris galietosum ruprechtii. Публикация уже обнародованных описаний без ссылки на автора может служить источником недоразумений, поскольку описания могут ошибочно восприниматься как новые.
Приведенный Г.Д. продромус травяных сообществ заведомо неполон. На
данном отрезке Оби выявлено не 12, а 36 «травяных» ассоциаций из 7 классов: Lemnetea (3), Potametea (6), Isoëto-Nanojuncetea (1), Bidentetea (2),
Phragmito-Magnocaricetea (20), Molinio-Arrhenatheretea (3), ScheuchzerioCaricetea (1) [11, 13–15]. Сравнение с растительностью пойм Оби и Иртыша
Г.Д. ведет по самым первым работам [16, 17], игнорируя последующие [12,
14, 18–20 и мн. др.].
Глава 4 «Сукцессивные ряды сообществ по синтаксонам флористической
классификации» посвящена пойменной растительности данного отрезка Оби
в целом с охватом как травяных, так и древесно-кустарниковых сообществ.
Г.Д. разделяет концепцию моноклимакса [21], но приводимые ею сукцессионные схемы, по сути, не отличаются от схем сигматистов [22. Р. 321].
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
188
Г.С. Таран
Браун-Бланке критикует уподобление климакса организму: «...Clements in a
flight of imagination compares the climax community to an organism which has
birth, growth, maturity, and death. <...> The facts show these opinions to be wholly incorrect [22. Р. 315]». Следование Ф. Клементсу скорее формальное. Заимствуется несколько звучных терминов: климакс, субклимакс, гидрархный
(ряд), ксерархный, мезархный [21, 23]. При этом даже не обсуждается, что
Г.Д. понимает под климаксом в Среднем Приобье. В термины гидрархный,
мезархный, ксерархный вкладывается трактовка, отличная от оригинальной. Г.Д. полагает (с. 89, 104, 112), что их можно понимать в относительном
плане, для обозначения сукцессий, протекающих на разных высотных уровнях пойменного рельефа: нижнем (гидрархный ряд), среднем (мезархный) и
высоком (ксерархный ряд). Для травяных сообществ Г.Д. указывает 2 сукцессионных ряда, которые называет гидрархным (водная растительность) и
мезархным (пионерные группировки отмелей, болотистые и влажные луга),
что неверно. Пойма формируется рекой, и все первичные сукцессии в ней
следует относить к гидрархному ряду [24], разделяя его на геосерии (на глинах), псаммосерии (на песках) и гидросерии (в озерах и старицах). Термин
«мезархный» применяется для вторичных смен, идущих при стабильном
среднем увлажнении [23].
Без какой-либо аргументации Г.Д. принимает в качестве меры сукцессионной близости синтаксонов показатели флористического сходства ценофлор, вычисляемые на основе мер включения и коэффициента Съеренсена. Между тем,
такое сходство может объясняться всего лишь соседством ценозов либо временным совпадением экологических условий в пространственно разделенных сукцессионных рядах, имеющих различные векторы развития. Количественный
показатель сходства не указывает, какой качественной частью перекрываются
ценофлоры: это могут быть экологически разные группы видов.
В изучении сукцессий преобладают косвенные методы, в основе которых
лежит интерпретация пространственных рядов как сукцессионных. Следует
очень осторожно подбирать фитоценозы в качестве звеньев моделируемого
сукцессионного ряда. В него следует объединять описания из однотипных
ландшафтных выделов. Единицами такого рода являются острова, пояс меандрирования основного русла Оби и внутрипойменных проток, участки голоценовой террасы Оби и многие другие [25].
Схема «гидрархного ряда» (рис. 4.4) включает 3 группы описаний, интерпретированных как сукцессионные стадии: 1 → 2 → 3. При этом в группах 1 и 2 массив описаний разнороден, поскольку получен на островах, в поясах меандрирования Оби, проток и на поверхностях голоценовой террасы.
Описания группы 3 все выполнены на поверхностях голоценовой террасы,
но относятся к 3 разным ассоциациям. Группы 1 и 2 объединяют ценозы
земноводных участков, поэтому неверно указывать в качестве их преемника
ценозы группы 3, приуроченные к берегам глубоких стариц на поверхностях высокого уровня поймы.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Г.Д. Дымина. Классификация, динамика и онтогенез
189
Сукцессионная схема «мезосерии» (рис. 4.5) состоит из 2 ветвей. Основная ветвь представлена 6 звеньями: от жерухово-хвощовой ассоциации до
осиновых и березовых лесов. Эта схема далека от реальности. Осиновые
и березовые леса приурочены к высоким прирусловым гривам. Растительность межгривных понижений и обширных озерных депрессий образует
особую линию развития, вершиной которой являются кочковатые кустарниково-березовые болота [26, 27]. Вторая ветвь включает 3 звена: речнохвощовая ассоциация → остроосочники заболоченные → заболоченные кустарники. В ней не указаны многие ассоциации лугов и болот, например Caricetum
aquatilis Savich 1926, Carici aquatilis–Comaretum и Carici aquatilis–Salicetum lapponum Taran 1993 [11, 26]. Терминальной для этой линии развития
является асс. Carici juncellae–Salicetum rosmarinifoliae Korolyuk et Taran in
Taran 1993 [26, 27].
Характеристика лесов и кустарников дается на уровне фитоценонов,
несмотря на то что их классификация полностью завершена [26–30]. Они
представлены в синоптической табл. 4.2: 1 – молодые, 2 – средневозрастные, 3 – старые ивняки, 4 – тополевники и очень старые ивняки, 5 – осиново-березовые и березово-осиновые леса, 6 – заболоченные кустарники. Эти
фитоценоны синтаксономически и экологически весьма гетерогенны. Лишь
фитоценон № 5 четко соответствует асс. Spiraeo salicifoliae–Populetum tremulae Taran 1993 [28, 29].
Путем расчета флористического сходства фитоценоны древесной и кустарниковой растительности выстраиваются в единый ряд смен (рис. 4.11),
ошибочно называемый мезархным. Г.Д. заключает: «В конце сукцессивного
ряда древесной, а также и травяной растительности пойм стоят две ассоциации – осиново-березовые леса и заболоченные кустарники. Они образуют
единый комплекс, и их можно рассматривать как климакс пойм или субклимакс таежной зоны (с. 103)». В общем это неверно: субклимакс поймы зависит
от величины реки. Чем меньше водоток, тем ближе растительность высокой
поймы к растительности надпойменных террас. Замечу, что на обских островах встречаются мелкоконтурные сосновые леса [29], о чем Г.Д. не упоминает.
С.В. Васильев [31], изучавший лесообразование на данном отрезке поймы, указывает 3 ряда первично-аллювиагенных и 4 ряда вторично-аллювиагенных смен, а также особый ряд развития для лесных и кустарниковых
болот голоценовой террасы. Сукцессионные связи между травяными, кустарниковыми и лесными ценозами сложны [11, 27, 30, 32]. Оригинальна
динамика растительности в приустьевых сорах притоков Оби [15]. Таким
образом, все схемы Г.Д. далеки от реальности.
Глава 5 «Природные сукцессии и антропогенная растительность» основана также на примерах с юга Западной Сибири и поймы Оби. В табл. 5.1
представлены 82 вида поймы, разделенные на 5 групп по реакции на антропогенные нарушения: от резко отрицательной до резко положительной.
Такое деление без привязки к экологической специфике экотопа и характеру
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
190
Г.С. Таран
нарушения не вполне ясно, поскольку реакция вида на нарушения (выпас,
косьбу) варьирует при различных условиях [11].
Основное содержание главы 6 «Сукцессивные ряды. Климакс и онтогенез сообществ» ранее публиковалось препринтом [33]. Глава имеет вид
обзора, в котором цитируется много источников. Подход Г.Д. к освещению
вопроса необычен [33: с. 4]: «Для подтверждения выдвигаемых положений
автор умышленно в меньшей степени использует свои наблюдения как лица,
заинтересованного в доказательстве выдвигаемых положений, и в большей
степени наблюдения и факты, полученные другими авторами». Полагаю,
большинство исследователей, напротив, при решении теоретических вопросов опирается, в первую очередь, на собственный полевой опыт. Наличие
такого опыта позволяет правильно воспринимать данные других авторов.
Предлагаемые в главе теоретические положения разбавлены большим
количеством ссылок, которые затемняют изложение и мешают автору доказывать собственные тезисы.
По Г.Д., любую живую систему можно рассматривать как организм. Растительность на уровне ландшафта образует «организм биоценотического
уровня», который пребывает в сукцессионной динамике, стремясь достичь
биологического климакса. Полный набор растительных смен от инициальных до климаксовых ценозов (на определенном типе местобитаний) называется сукцессивным рядом. Один оборот сукцессивного ряда называется
сукцессивным циклом (СЦ). СЦ – это индивид растительного надорганизма.
Полный набор растительных смен, его составляющих, – его полный онтогенез, а сукцессивные стадии – стадии онтогенеза, от пионерных (ювенильных) до климаксовой (сенильной). Как и у всякого организма, сенильная
стадия со временем распадается, сменяясь более молодыми. С отмиранием сенильной стадии завершается онтогенез элементарного сукцессивного
ряда, или сукцессивного цикла. Глубина сукцессивного отката к ранним стадиям зависит от степени нарушения сенильного сообщества. Если нарушение невелико, повторение СЦ происходит в сокращенном виде. Такой вариант возобновления климакса Г.Д. сравнивает с вегетативным размножением
растений. При отсутствии внешних нарушений поддержание климакса происходит в форме климакс-мозаики. Это также СЦ в наиболее краткой форме.
СЦ вначале повторялись под влиянием внешних причин, но со временем в
силу естественного отбора способность к повторениям стала внутренним
свойством климакс-организма. Действие естественного отбора реализуется
благодаря наличию наследственности и изменчивости. «…Наследственная
память биоценозов представляет собой совокупность геномов всех видов,
входящих в биоценоз» (с. 163). Окончательный вывод таков: «СЦ – эволюционно сложившаяся, самовозобновляющаяся форма жизни, информационная память которой заложена в образующих ее видах. Их по существу и
можно рассматривать как своеобразные хромосомы биоценотического уровня организации материи» (с. 163).
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Г.Д. Дымина. Классификация, динамика и онтогенез
191
Вгляды Г.Д. на сукцессии имеют спекулятивный характер. Ее собственные исследования на юге Дальнего Востока [34] и в Западной Сибири не
дают аргументов в пользу моноклимакса и «онтогенеза фитоценозов». Аргументация неубедительна и основана на «философских» доводах: «Если
признавать реальность существования квантов биогеоценотического уровня, то ими и должна определяться динамика популяций. Согласно приведенной нами ранее экосистемной теории эволюции, развитие низших уровней
экосистемы зависит от высших, Земля – от Солнца, популяции – от БГЦ
[биогеоценозов]» (с. 147). «Отрицание онтогенеза у биоценозов равносильно непризнанию их эволюции, а следовательно, и вообще возникновения и
существования форм организации материи этого уровня» (с. 150).
Рассматривая растительный покров в отрыве от географической среды,
Г.Д. путает причину и следствие. Она полагает, что стремление достичь климакса стало врожденным свойством климакс-организма, который, обладая
своего рода целеполаганием, пытается активно трансформировать экотоп в
намерении продолжить сукцессию.
Несостоятельность такого подхода особенно ярко проявляется применительно к поймам. Повторяемость растительных смен в поймах есть отражение эрозионно-аккумулятивных циклов развития рельефа. «Поскольку
основные компоненты пойменных ПТК [природно-территориальных комплексов] формируются при прямом или косвенном участии русловых или
гидрологических процессов, то и сами ПТК, и ландшафтная структура пойм
являются результатом их воздействия. Речные наносы составляют литогенную основу пойменных ПТК, а созданный русловыми процессами рельеф
пойм определяет структуру ландшафтов – набор фаций, урочищ и их распределение в пределах пойменных массивов. <...> В процессе миграции
русла по дну долины различные элементы пойменного рельефа многократно
воспроизводятся; тем самым одновременно воспроизводится и характерный
для каждого ландшафта набор фаций и урочищ, воссоздается основа пространственной структуры пойменного ландшафта» [35. С. 179].
Если и допускать наличие «памяти», обусловливающей повторяемость сукцессий, то она реализуется не в ценозах, а на уровне относительно независимых
видовых популяций региональной флоры. Внутренней детерминированности
в прохождении сукцессий нет: их темп и форма задаются извне динамикой
ландшафта и набором предлагаемых экотопов. Увы, ландшафтно-географическая конкретика Г.Д. чужда: ни экологические режимы ключевых полигонов,
ни детальная топографическая привязка изученных фитоценозов, ни даже полная синтаксономия растительности ее не интересуют. Рассуждения ведутся на
спекулятивном уровне. Излагая материал по пойме Оби, Г.Д. последовательно
игнорирует все важнейшие научные результаты, полученные в этой области за
последние четверть века: детальную типологию пойменного рельефа Оби [25],
полностью завершенную классификацию растительности пойм Оби и Иртыша
в пределах среднетаежной подзоны [11–15,18–20, 26–30], результаты модели-
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
192
Г.С. Таран
рования полных сукцессионных рядов [36, 31, 32] и их отдельных фрагментов
[11, 13, 15, 27, 29, 30]; данные восьми- и восемнадцатилетних стационарных
исследований растительности в поймах Иртыша и Оби [36, 37].
Завершает работу глава 7 «Общие выводы», из которых прокомментирую
лишь некоторые. «В каждом физико-географическом районе обычно выделяется небольшое число ассоциаций, в среднем 1–2 (3) десятка» (с. 177).
Это утверждение противоречит опубликованным данным. В пойме Оби на
разных ключевых полигонах выявлено от 51 до 57 асс.: 51 на Вах-Тымском
отрезке [14], 57 – на Сургутском [20], 53 – на Елизаровском [12]. В пойме
Амура [38] выявлено 45 асс. (за вычетом водной растительности), что совпадает с данными по Оби.
«Проведение флористической классификации в новых, ранее не исследованных в этом плане районах невозможно без ознакомления с имеющимися флористическими классификациями» (с. 177). «Успешность построения
сукцессивных рядов и их полнота зависят от тщательности выявления всего
богатства сообществ района вне зависимости от длительности их существования, занимаемой площади, частоты встречаемости и т.д. Для выявления
начальных стадий сукцессии обязателен учет сообществ на любых экотопах, включая глубоко нарушенные любого происхождения…» (с. 177–178).
Как видим, сама Г.Д. этим советам не следует.
«В каждой местности, благодаря распределению влаги по элементам рельефа, можно выделить три основных относительных сукцессивных ряда
развития растительности: гидрархный, мезархный и ксерархный. Иногда
последний не выражен (например, на исследованном автором участке поймы Оби)» (с. 178). На самом деле разнообразие сукцессий определяется
структурой ландшафта: «Эволюционных рядов на поймах малых рек насчитывается 2–3, на крупных – до 20–25, так как число вариантов развития
ландшафтной структуры резко возрастает. <...> Русловые процессы определяют преобладающий режим формирования урочищ, направление эволюции, число звеньев эволюционного ряда (ПТК), количество вариантов развития и точки разветвления эволюционного ряда» [35. С. 186].
Рецензируемую книгу трудно назвать актуальной работой. Скорее, это
литературный памятник тому состоянию, в котором синтаксономия в Западной Сибири пребывала 20 лет назад [2]. Полезным компонентом являются
описания. Увы, описания из поймы Оби заметно обесценены из-за отсутствия сведений об авторах, датах, локалитетах. А самовольная публикация
Г.Д. Дыминой чужих описаний будет служить хрестоматийным примером
нарушения норм научной этики.
Литература
1. Ермаков Н.Б., Королюк А.Ю., Лащинский Н.Н. Флористическая классификация мезофильных травяных лесов Южной Сибири. Новосибирск, 1991. 96 с. (Препринт /
ЦСБС СО РАН.)
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Г.Д. Дымина. Классификация, динамика и онтогенез
193
2. Дымина Г.Д. Классификация, динамика и онтогенез травяных фитоценозов (на примере регионов Сибири и Дальнего Востока) : автореф. дис. … д-ра биол. наук. Новосибирск, 1989. 31 с.
3. Steffen H. Vegetationskunde von Ostpreussen. Pflanzensociologie. Jena: G. Fischer, 1931.
Bd. 1. 406 s.
4. Дымина Г.Д., Ершова Э.А. Пионерные сообщества поймы Средней Оби. Их особенности и классификация // Ботанические исследования Сибири и Казахстана. Кемерово,
2008. Вып. 14. С. 30–42.
5. Weber H.E., Moravec J., Theurillat J.-P. International Code of Phytosociological Nomenclature. 3rd edition // J. Veg. Sci. 2000. Vol. 11, № 5. P. 739–768.
6. Раменский Л.Г., Цаценкин И.А., Чижиков О.Н., Антипин Н.А. Экологическая оценка
кормовых угодий по растительному покрову. М. : Сельхозгиз, 1956. 472 с.
7. Koch W. 1926. Die Vegetationseinheiten der Linthebene unter Berücksichtingung der Verhältnisse in der Nordostschweiz // Jahrb. St. Gall. Naturwiss. Ges. 61/2. S. 1–144.
8. Blažkova D. 1971. Zu den phytozönologischen Problemen der Assoziation Caricetum gracilis Almquist 1929 // Folia Geobot., Phytotax. Vol. 6. P. 43–80.
9. Григорьев И.Н., Соломещ А.И., Алимбекова Л.М., Онищенко Л.И. Влажные луга Республики Башкортостан: синтаксономия и вопросы охраны. Уфа : Гилем, 2002. 157 с.
10. Korotkov K.O., Morozova O.V., Belonovskaja E.A. The USSR vegetation syntaxa prodromus. Moscow : publ. by Dr. G.E. Vilchek, 1991. 346 p.
11. Таран Г.С. Синтаксономия лугово-болотной растительности поймы Средней Оби (в
пределах Александровского района Томской области). Новосибирск, 1995. 76 с. (Препринт / ЦСБС СО РАН.)
12. Таран Г.С., Седельникова Н.В., Писаренко О.Ю., Голомолзин В.В. Флора и растительность Елизаровского государственного заказника (нижняя Обь). Новосибирск : Наука, 2004. 212 с.
13. Таран Г.С. Водная растительность (Lemnetea, Potametea) поймы р. Оби (в пределах
Александровского района Томской области) // Растительность России. 2008. № 12.
С. 68–75.
14. Таран Г.С. Флора и растительность поймы Средней Оби (в пределах Александровского района Томской области) : автореф. дис. ... канд. биол. наук. Новосибирск, 1996.
17 с.
15. Таран Г.С. Ассоциация Cypero-Limoselletum (Oberd. 1957) Korneck 1960 (IsoëtoNanojuncetea) в пойме Средней Оби // Растительность России. 2001. № 1. С. 43–56.
16. Ильина И.С., Денисова А.В., Миркин Б.М. Синтаксономия растительности низовий
Оби и Иртыша. I. Общая характеристика синтаксономии. Классы Salicetea purpureae
Moor 1958 и Querco-Fagetea Br.-Bl. et Vlieger in Vlieger 1937. М., 1988. 36 с. Деп. в
ВИНИТИ 08.08.88, № 6916–В88.
17. Ильина И.С., Денисова А.В., Миркин Б.М. Синтаксономия растительности низовий
Оби и Иртыша. II. Классы Phragmitetea Tx. et Prsg. 1942 и Molinio-Arrhenatheretea
R.Tx. 1937 em. 1970. М., 1988. 29 с. Деп. в ВИНИТИ 08.08.88, № 6917–В88.
18. Прокопьев Е.П. Луговая растительность поймы Иртыша. Томск, 1990. 109 с. Деп. в
ВИНИТИ 31.01.90, № 581–В91.
19. Миркин Б.М., Денисова А.В., Голуб В.Б. и др. Синтаксономия травяной растительности поймы Среднего Иртыша. М., 1991. 55 с. Деп. В ВИНИТИ 15.01.91, № 258–В91.
20. Таран Г.С., Тюрин В.Н. Очерк растительности поймы Оби у города Сургута // Биологические ресурсы и природопользование. Сургут, 2006. Вып. 9. С. 3–54.
21. Clements F.E. Plant succession: an analysis of the development of vegetation. Washington :
Carnegie Inst. Publ. House, 1916. 512 p.
22. Braun-Blanquet J. Plant sociology: the study of plant communities. McGraw–Hill, New
York, NY, USA, 1932. XVIII + 439 p.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
194
Г.С. Таран
23. Разумовский С.М. Закономерности динамики биоценозов. М. : Наука, 1981. 231 с.
24. Александрова В.Д. Изучение смен растительного покрова // Полевая геоботаника. М. ;
Л. : Наука, 1964. Т. 3. С. 300–447.
25. Васильев С.В., Седых В.Н. Пойма Оби на аэрокосмических снимках. Красноярск,
1984. 44 с. (Препринт / ИЛиД СО РАН.)
26. Таран Г.С. Синтаксономический обзор кустарниковой растительности поймы Средней Оби (александровский отрезок) // Сибирский биологический журнал. 1993.
Вып. 6. С. 79–84.
27. Таран Г.С. Ивняки и березово-кустарниковые болота с Salix rosmarinifolia L. на ВахТымском отрезке поймы Оби // Вестник Оренбургского государственного университета. 2009. № 4. С. 98–103.
28. Таран Г.С. Синтаксономический обзор лесной растительности поймы Средней
Оби (александровский отрезок) // Сибирский биологический журнал. 1993. Вып. 6.
С. 85–91.
29. Таран Г.С. Осиновые и березовые леса поймы Средней Оби (Spiraeo salicifoliaePopuletum tremulae Taran 1993) // Ботанические исследования Сибири и Казахстана.
Барнаул, 1998. Вып. 4. С. 82–89.
30. Таран Г.С. Ивовые леса поймы Оби между устьями Тыма и Ваха (Salicetea purpureae
Moor 1958) // Ботанические исследования Сибири и Казахстана. Барнаул, 1999.
Вып. 5. С. 47–56.
31. Васильев С.В. Лесообразование в пойме Средней Оби : автореф. дис. … канд. биол.
наук. Красноярск, 1988. 17 с.
32. Таран Г.С. Сукцессионные смены растительности в пойме Средней Оби при свободном меандрировании // Человек и вода : тез. докл. к научно-практ. конф. Томск, 1990.
С. 138–141.
33. Дымина Г.Д. Онто- и филоценогенез. Объем основной эволюирующей единицы фитоценоза. Новосибирск, 1987. 53 с. (Препринт / ЦСБС СО РАН.)
34. Дымина Г.Д. Луга юга Дальнего Востока. Новосибирск : Наука, 1985. 190 с.
35. Сурков В.В. Ландшафтообразующая роль русловых и гидрологических процессов в
речных долинах // Эрозия почв и русловые процессы. М., 2010. Вып. 17. С. 154–192.
36. Природа таежного Прииртышья. Новосибирск : Наука, 1987. 257 с.
37. Шепелева Л.Ф. Организация луговых сообществ поймы Средней Оби : автореф.
дис. ... д-ра биол. наук. Новосибирск, 1998. 34 с.
38. Ахтямов М.Х. Синтаксономия растительности поймы реки Амур : автореф. дис. ...
д-ра биол. наук. Владивосток, 2000. 42 с.
Поступила в редакцию 04.06.2011 г.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Г.Д. Дымина. Классификация, динамика и онтогенез
195
Tomsk State University Journal of Biology. 2011. № 4 (16). P. 185–196
Georgy S. Taran
West-Siberian Branch of V.N. Sukachev Institute of Forest of Siberian Branch
of Russian Academy of Sciences, Novosibirsk, Russia
G.D. DYMINA. CLASSIFICATION, DYNAMICS AND ONTOGENY OF
PHYTOCOENOSES (ON THE EXAMPLES OF REGIONS OF SIBERIA).
NOVOSIBIRSK: NSPU PRESS, 2010. 213 P.
The reviewed book includes 7 chapters, 46 tables, 30 figures and 625 references.
In chapter 1 “General description of the work”, the history of syntaxonomic studies in
Western Siberia is traced and material and methods of the work are characterized. The
book contains 180 geobotanical relevés, 39 of which were made by G.S. Taran. The last
ones are published in the book without G.S. Taran permit. Moreover, the authorship of
the 35 relevés is not shown.
In chapter 2 “Vegetation of the Western Siberia south (Ob river right-bank territory
within the limits of Novosibirsk region)”, 21 associations are characterized. They
belong to 3 vegetation classes: Molinio-Arrhenatheretea (8 ass.), Festuco-Brometea
(10 ass.), Querco-Fagetea (3 ass.). It is more correct to include 3 last associations in
the class Brachypodio pinnati-Betuletea pendulae.
In chapter 3 “Middle Ob floodplain vegetation (the north of Tomsk region)”, the
prodromus of grass communities is found. It includes 12 associations from 4 classes:
Potametea (2), Phragmito-Magnocaricetea (8), Molinio-Arrhenatheretea (1),
Scheuchzerio-Caricetea fuscae (1). This prodromus is wittingly incomplete. For this
floodplain area, 36 grass associations from 7 vegetation classes were already described
in geobotanical literature: Lemnetea (3), Potametea (6), Isoëto-Nanojuncetea (1),
Bidentetea (2), Phragmito-Magnocaricetea (20), Molinio-Arrhenatheretea (3),
Scheuchzerio-Caricetea (1). In addition, at least 10 forest and shrubbery associations
from 3 classes were revealed there: Salicetea purpureae (4), Alnetea glutinosae (3),
Brachypodio pinnati-Betuletea pendulae (3).
Chapter 4 (“Successive series of communities according syntaxa of floristic
classification”) examines the vegetation of this Ob river reach on the whole, with
envelopment of grass, shrubbery and forest communities. G.D. Dymina shares
F. Clements’ monoclimax conception but her successive schemes per se do not differ
from schemes in Braun-Blanquet’s works. The conforming to F. Clements is rather
formal. She borrows some sonorous terms: climax, subclimax and hydrarch, mesarch
and xerarch (series). At the same time, G.D. Dymina doesn’t even discuss what she
regards as the climax in the middle Ob territory. In terms hydrarch, mesarch and
xerarch, she puts interpretation which differs from the original. The description of
forests and shrubberies is given at a phytocoenon level, in spite of the fact that their
syntaxonomy has interily completed. These phytocoenons are rather heterogeneous in
syntaxonomical and ecological relation. They are lined up single series of changes
which are by mistake named mesarch. Meanwhile, S.V. Vasiliev, who studied forest
dynamics in this Ob floodplain area more than 20 years ago, showed 3 series of primary
and 4 series of secondary alluviagenic successions and also special line of changes for
the forest and shrubbery bogs of Ob holocene terrace. Successive connections between
grass, shrubbery and forest communities are not less complete. Original vegetation
dynamics is observed in mouth shors of Ob river tributaries. Thus, all G.D. Dymina’s
successive schemes are far from reality.
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
196
Г.С. Таран
In chapter 5 “Natural successions and anthropogenic vegetation”, 82 floodplain
species are divided into 5 groups according to their reaction to anthropogenic
disturbances: from distinctly negative to distinctly positive. Such division without
attaching to ecological specificity of an ecotope and the disturbance nature is not quite
clear because species reaction to disturbances (pasture, mowing) varies under different
conditions.
In chapter 6 “Successive series. Climax and ontogeny of communities”, it is alleged
that any biological system may be regarded as an organism. In G.D. Dymina’s opinion,
vegetation at landscape level forms “organism of biocoenotic level” which stays in
successive dynamics, pressing towards biological climax. Analysing vegetation cover
in isolation from geographical environment, G.D. Dymina confuses cause and effect.
She believes that striving for climax became a native characteristic of climax organism
which has in a sense purposefulness and tries actively to transform ecotope in order
to continue succession. The unfoundedness of such point of view is especially brightly
revealed conformably to floodplains. The recurrence of vegetation changes in floodplains
is a reflection of erosion and accumulation cycles of relief development. Intrinsic
determinancy in passing successions is absent: their pace and form are determined
from outside by landscape dynamics and set of offered ecotopes. Alas, landscape and
geographical concreteness is alien to G.D. Dymina: she is not interested in ecological
regimes of key areas, detailed topographic localization of studied phytocoenoses and
even complete syntaxonomy of discussed vegetation. The reasoning is being held at a
speculative level. Stating the facts about Ob floodplain, G.D. Dymina disregards all
the most important scientific attainments won in this sphere for the last quarter of the
century: the detailed typology of Ob floodplain relief, quite completed syntaxonomy of
Ob and Irtish floodplain vegetation within the limits of middle taiga subzone, the results
of the modelling complete and fragmentary successive lines, the data of 8- and 18-year
stationary researches of the vegetation in lower Irtish and middle Ob floodplains.
The reviewed book may hardly be named a topical work. It is rather a literary
tombstone to that state of the West Siberian syntaxonomy in which it used to be 20 years
ago. A useful component of the work is geobotanical relevés. Alas, the relevés from
Ob floodplain are appreciably cheapened because of the absence of information about
their author, datum and localization. And unauthorized publication by G.D. Dymina of
other’s relevés will serve as a reading-book example of scientific ethics norms breach.
Received June 4, 2011
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Вестник Томского государственного университета. Биология. 2011. № 4 (16). С. 197–201
СВЕДЕНИЯ ОБ АВТОРАХ
Абылкасымова Гульнар Мухтаргазыевна – младший научный сотрудник лаборатории
молекулярной генетики Института общей генетики и цитологии Комитета науки Министерства образования и науки Республики Казахстан (Республика Казахстан, г. Алматы).
E-mail: iggc@mail.ru
Алобайди Халид Хашем – аспирант кафедры ботаники, физиологии растений и агробиотехнологии аграрного факультета Российского университета дружбы народов (г. Москва).
E-mail: khalid7877@yahoo.com
Ананин Александр Афанасьевич – кандидат биологических наук, заместитель директора по научной работе ФГУ «Государственный природный биосферный заповедник
«Баргузинский» (г. Улан-Удэ).
E-mail: a_ananin@mail.ru
Артемов Глеб Николаевич – кандидат биологических наук, научный сотрудник лаборатории эволюционной цитогенетики ОСП «Научно-исследовательский институт биологии и биофизики Томского государственного университета», ассистент кафедры цитологии и генетики Биологического института Томского государственного университета
(г. Томск).
E-mail: g_artemov@mail.ru
Афонников Дмитрий Аркадьевич – кандидат биологических наук, заведующий сектором эволюционной биоинформатики лаборатории теоретической генетики Института
цитологии и генетики СО РАН (г. Новосибирск).
E-mail: ada@bionet.nsc.ru
Бабешина Лариса Геннадьевна – кандидат биологических наук, доцент кафедры
фармакогнозии Сибирского государственного медицинского университета (г. Томск).
E-mail: lbabeshina@yandex.ru
Башмакова Елена Борисовна – младший научный сотрудник лаборатории физиологических и молекулярных механизмов адаптации Института физиологии растений
им. К.А. Тимирязева РАН (г. Москва).
E-mail: elenab_77@mail.ru
Блохина Светлана Леонидовна – инженер 11-й категории отдела оценки воздействия на окружающую среду Томского научно-исследовательского и проектного института нефти и газа (ОАО «ТомскНИПИнефть») (г. Томск).
E-mail: seredina_v@mail.ru
Большаков Михаил Алексеевич – доктор биологических наук, профессор, профессор кафедры физиологии человека и животных Биологического института Томского государственного университета; старший научный сотрудник отдела физической электроники Института
сильноточной электроники СО РАН (г. Томск).
E-mail: mbol@ngs.ru
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
198
Сведения об авторах
Бордей Римма Ханифовна – младший научный сотрудник лаборатории ландшафтной экологии Научно-исследовательского института экологии и природопользования
Севера Сургутского государственного университета (г. Сургут, Ханты-Мансийский автономный округ – Югра).
E-mail: Ar80@yandex.ru
Бурмистрова Татьяна Ивановна – кандидат химических наук, старший научный
сотрудник, зав. лабораторией физико-химических исследований ГНУ «Сибирский научно-исследовательский институт сельского хозяйства и торфа Россельхозакадемии»
(г. Томск).
E-mail: burmistrova@sibniit.tomsknet.ru
Воробьёв Юрий Николаевич – доктор физико-математических наук, старший научный сотрудник, главный научный сотрудник лаборатории исследования модификации
биополимеров Института химической биологии и фундаментальной медицины СО РАН
(г. Новосибирск).
E-mail: ynvorob@niboch.nsc.ru
Генаев Михаил Александрович – аспирант сектора эволюционной биоинформатики
лаборатории теоретической генетики Института цитологии и генетики СО РАН
(г. Новосибирск).
E-mail: mag@bionet.nsc.ru
Гриднева Вера Ивановна – доктор биологических наук, профессор, профессор кафедры физиологии человека и животных Биологического института Томского государственного университета (г. Томск).
Гунбин Константин Владимирович – кандидат биологических наук, научный сотрудник сектора эволюционной биоинформатики лаборатории теоретической генетики
Института цитологии и генетики СО РАН (г. Новосибирск).
E-mail: genkvg@bionet.nsc.ru
Дергачева Мария Ивановна – доктор биологических наук, профессор, главный научный сотрудник Института почвоведения и агрохимии СО РАН (г. Новосибирск); профессор кафедры почвоведения и экологии почв Томского государственного университета
(г. Томск).
E-mail: mid555@yandex.ru
Ефимова Марина Васильевна – кандидат биологических наук, доцент кафедры физиологии растений и биотехнологии Биологического института Томского государственного университета (г. Томск).
E-mail: stevmv555@gmail.com
Жаркова Любовь Петровна – кандидат биологических наук, ассистент кафедры
физиологии человека и животных Биологического института Томского государственного
университета; инженер отдела физической электроники Института сильноточной электроники СО РАН (г. Томск).
E-mail: Zharkova_Lubov@mail.ru
Жилякова Татьяна Петровна – кандидат биологических наук, старший научный
сотрудник лаборатории биопрепаратов ГНУ «Сибирский научно-исследовательский институт сельского хозяйства и торфа Россельхозакадемии» (г. Томск).
E-mail: zhilyakova@sibniit.tomsknet.ru
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Сведения об авторах
199
Заболотская Анастасия Владимировна – кандидат технических наук, старший научный сотрудник отдела новых материалов Томского государственного университета
(г. Томск).
E-mail: salon7878@mail.ru
Замощина Татьяна Алексеевна – профессор, доктор биологических наук, профессор кафедры физиологии человека и животных Биологического института Томского государственного университета; профессор кафедры фармакологии Сибирского государственного медицинского университета (г. Томск).
E-mail: beladona@hotmail.ru
Захарова Елена Юрьевна – кандидат биологических наук, научный сотрудник лаборатории эволюционной экологии Института экологии растений и животных УрО РАН
(г. Екатеринбург).
E-mail: zakharova@ipae.uran.ru
Иванов Владимир Владимирович – кандидат биологических наук, доцент кафедры
биохимии и молекулярной биологии Сибирского государственного медицинского университета; старший научный сотрудник НИИ онкологии ТНЦ СО РАМН (г. Томск).
E-mail: iseivv@mail.ru
Князева Ирекле Рашидовна – кандидат биологических наук, доцент кафедры нормальной физиологии Сибирского государственного медицинского университета; ведущий инженер отдела физической электроники Института сильноточной электроники
СО АН (г. Томск).
E-mail: kir@rubl.tomsk.ru
Ковтун Ирина Сергеевна – студентка кафедры физиологии растений и биотехнологии Биологического института Томского государственного университета (г. Томск).
E-mail: kovtunirina@sibmail.com
Кузнецов Александр Александрович – младший научный сотрудник Гербария
им. П.Н. Крылова Биологического института Томского государственного университета
(г. Томск).
E-mail: Kuznetsov_aa@bio.tsu.ru
Кутенков Олег Петрович – ведущий инженер-электроник отдела физической электроники Института сильноточной электроники СО РАН (г. Томск).
E-mail: Kutenkov@lfe.hcei.tsc.ru
Лапирова Татьяна Борисовна – кандидат биологических наук, старший научный сотрудник лаборатории физиологии и токсикологии водных животных Института биологии
внутренних вод им. И.Д. Папанина РАН (п. Борок, Ярославская обл.).
E-mail: ltb@ibiw.yaroslavl.ru
Мараей Мухаммед Мукбель – аспирант кафедры ботаники, физиологии растений и
агробиотехнологии аграрного факультета Российского университета дружбы народов (г.
Москва).
E-mail: mareemohammed@yahoo.com
Медведев Кирилл Евгеньевич – старший лаборант-исследователь лаборатории теоретической генетики Института цитологии и генетики СО РАН (г. Новосибирск).
E-mail: kirill-medvedev@yandex.ru
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
200
Сведения об авторах
Некрасова Ольга Анатольевна – кандидат биологических наук, доцент кафедры экологии биологического факультета Уральского федерального университета им. первого
президента России Б.Н. Ельцина (г. Екатеринбург).
E-mail: o_nekr@mail.ru
Олонова Марина Владимировна – доктор биологических наук, профессор кафедры
экологического менеджмента Биологического института Томского государственного
университета (г. Томск).
E-mail: olonova @green.tsu.ru
Ослина Татьяна Сергеевна – аспирантка лаборатории эволюционной экологии Института экологии растений и животных УрО РАН (г. Екатеринбург).
E-mail: zakharova@ipae.uran.ru
Просекина Елена Юрьевна – кандидат биологических наук, доцент кафедры физиологии человека и животных Биологического института Томского государственного университета (г. Томск).
E-mail: physiol@bio.tsu.ru
Ралдугина Галина Николаевна – кандидат биологических наук, ведущий научный
сотрудник лаборатории физиологических и молекулярных механизмов адаптации Института физиологии растений им. К.А. Тимирязева РАН (г. Москва).
E-mail: mareemohammed@yahoo.com
Ростов Владислав Владимирович – доктор физико-математических наук, зав. отделом физической электроники Института сильноточной электроники СО РАН; профессор
кафедры физики плазмы Томского государственного университета (г. Томск).
E-mail: rostov@lfe.hcei.tsc.ru
Садыков Марат Ергалиевич – инженер 1-й категории отдела мониторинга окружающей среды Томского научно-исследовательского и проектного института нефти и газа
(ТомскНИПИнефть, г. Томск).
E-mail: seredina_v@mail.ru
Середина Валентина Петровна – доктор биологических наук, профессор; профессор кафедры почвоведения и экологии почв Биологического института Томского государственного университета (г. Томск).
E-mail: seredina_v@mail.ru
Стегний Владимир Николаевич – доктор биологических наук, профессор, заведующий лабораторией эволюционной цитогенетики ОСП «Научно-исследовательского института биологии и биофизики Томского государственного университета», зав. кафедрой
цитологии и генетики Биологического института Томского государственного университета (г. Томск).
E-mail: stegniy@res.tsu.ru
Таран Георгий Семенович – кандидат биологических наук, старший научный сотрудник Западно-Сибирского филиала Института леса им. В.Н. Сукачева СО РАН (г. Новосибирск).
E-mail: gtaran@mail.ru
Томова Татьяна Александровна – кандидат биологических наук, доцент кафедры
медико-биологических дисциплин Томского государственного педагогического университета (г. Томск).
E-mail: eskovata@mail.ru
Copyright ОАО «ЦКБ «БИБКОМ» & ООО «Aгентство Kнига-Cервис»
Сведения об авторах
201
Турнаев Игорь Иванович – младший научный сотрудник сектора эволюционной биоинформатики лаборатории теоретической генетики Института цитологии и генетики СО
РАН (г. Новосибирск).
E-mail: turn@bionet.nsc.ru
Удинцев Сергей Николаевич – доктор медицинских наук, старший научный сотрудник, зав. лабораторией биопрепаратов ГНУ Сибирский научно-исследовательский институт сельского хозяйства и торфа Россельхозакадемии (г. Томск).
E-mail: doctorus1955@rambler.ru
Хасан Джалал Абдо Каид – аспирант кафедры ботаники, физиологии растений и
агробиотехнологии аграрного факультета Российского университета дружбы народов
(г. Москва).
E-mail: galal_9999@hotmail.com
Холодова Валентина Павловна – кандидат биологических наук, ведущий научный
сотрудник лаборатории физиологических и молекулярных механизмов адаптации Института физиологии растений им. К.А. Тимирязева РАН (г. Москва).
E-mail: v-pkholodova@ippras.ru
Храброва Наталья Валерьевна – кандидат биологических наук, старший научный
сотрудник лаборатории эволюционной цитогенетики ОСП «Научно-исследовательский
институт биологии и биофизики Томского государственного университета» (г. Томск).
E-mail: center_cu@res.tsu.ru
Шепелева Людмила Федоровна – доктор биологических наук, профессор; зав. кафедрой ботаники и экологии растений Сургутского государственного университета (г. Сургут, Ханты-Мансийский автономный округ – Югра).
E-mail: landscape-ecology@yandex.ru
Шкурихин Алексей Олегович – аспирант лаборатории эволюционной экологии Института экологии растений и животных УрО РАН (г. Екатеринбург).
E-mail: zakharova@ipae.uran.ru
Документ
Категория
Техника молодежи
Просмотров
199
Размер файла
8 000 Кб
Теги
университета, государственного, биологии, 2011, вестник, 1016, томского
1/--страниц
Пожаловаться на содержимое документа