close

Вход

Забыли?

вход по аккаунту

?

JNEUROSCI.1528-17.2017

код для вставкиСкачать
This Accepted Manuscript has not been copyedited and formatted. The final version may differ from this version.
Research Articles: Neurobiology of Disease
HuD and the Survival Motor Neuron protein interact in motoneurons and
are essential for motoneuron development, function and mRNA regulation.
1
1
1
Le Thi Hao , Phan Q. Duy , Min An , Jared Talbot
Beattie
2,3
2
4
, Chitra C. Iyer , Marc Wolman and Christine E.
1
1
The Ohio State University Wexner Medical Center Department of Neuroscience
2
Department of Biochemistry and Pharmacology
3
Department of Molecular Genetics and Center for Muscle Health and Neuromuscular Disorders, Columbus OH
43210.
4
The University of Wisconsin Department of Zoology, Madison WI 53706
DOI: 10.1523/JNEUROSCI.1528-17.2017
Received: 2 June 2017
Revised: 9 September 2017
Accepted: 27 September 2017
Published: 23 October 2017
Author contributions: L.T.H., J.T., M.W., and C.E.B. designed research; L.T.H., P.Q.P., M.A., C.C.I., and M.W.
performed research; L.T.H., P.Q.P., C.C.I., M.W., and C.E.B. analyzed data; M.W. and C.E.B. wrote the paper;
C.E.B. contributed unpublished reagents/analytic tools.
Conflict of Interest: The authors declare no competing financial interests.
We thank Dr. Wilfried Rossoll for the mCherry-HuD construct and the fish facilty staff for fish care. This work
was supported by NIH R56NS050414, RO1NS098780, and CureSMA to C. E. B. and The Greater Milwaukee
Foundation Shaw Scientist Award (133-AAA2656) to M. W.
Corresponding Author: beattie.24@osu.edu, Christine E. Beattie, 190 Rightmire Hall, 1060 Carmack Rd,
Columbus OH 43210
Cite as: J. Neurosci ; 10.1523/JNEUROSCI.1528-17.2017
Alerts: Sign up at www.jneurosci.org/cgi/alerts to receive customized email alerts when the fully formatted
version of this article is published.
Accepted manuscripts are peer-reviewed but have not been through the copyediting, formatting, or proofreading
process.
Copyright © 2017 the authors
+X'DQGWKH6XUYLYDO0RWRU1HXURQSURWHLQLQWHUDFWLQPRWRQHXURQVDQGDUHHVVHQWLDOIRUPRWRQHXURQ
GHYHORSPHQWIXQFWLRQDQGP51$UHJXODWLRQ
$EEUHYLDWHG7LWOH+X'DQG601LQPRWRQHXURQGHYHORSPHQWDQGIXQFWLRQ
/H7KL+DR3KDQ4'X\0LQ$Q-DUHG7DOERW&KLWUD&,\HU0DUF:ROPDQDQG&KULVWLQH(
%HDWWLH
7KH2KLR6WDWH8QLYHUVLW\:H[QHU0HGLFDO&HQWHU'HSDUWPHQWRI1HXURVFLHQFH'HSDUWPHQWRI
%LRFKHPLVWU\DQG3KDUPDFRORJ\'HSDUWPHQWRI0ROHFXODU*HQHWLFVDQG&HQWHUIRU0XVFOH+HDOWKDQG
1HXURPXVFXODU'LVRUGHUV&ROXPEXV2+7KH8QLYHUVLW\RI:LVFRQVLQ'HSDUWPHQWRI=RRORJ\
0DGLVRQ:,
&XUUHQW$GGUHVV-RKQV+RSNLQV8QLYHUVLW\'HSDUWPHQWRI1HXURVFLHQFH
&RUUHVSRQGLQJ$XWKRU
EHDWWLH#RVXHGX
&KULVWLQH(%HDWWLH
5LJKWPLUH+DOO
&DUPDFN5G
&ROXPEXV2+
3DJHV
)LJXUHV
:RUGV
$EVWUDFW
,QWUR
'LVFXVVLRQ
&RQIOLFWRI,QWHUHVW1RQH
$FNQRZOHGJHPHQWV:HWKDQN'U:LOIULHG5RVVROOIRUWKHP&KHUU\+X'FRQVWUXFWDQGWKHILVKIDFLOW\VWDII
IRUILVKFDUH7KLVZRUNZDVVXSSRUWHGE\1,+5165216DQG&XUH60$WR&(%
DQG7KH*UHDWHU0LOZDXNHH)RXQGDWLRQ6KDZ6FLHQWLVW$ZDUG$$$WR0:
$EVWUDFW
0RWRQHXURQVHVWDEOLVKDFULWLFDOOLQNEHWZHHQWKHFHQWUDOQHUYRXVV\VWHPDQGPXVFOHV,IPRWRQHXURQV
GRQRWGHYHORSFRUUHFWO\WKH\FDQQRWIRUPWKHUHTXLUHGFRQQHFWLRQVUHVXOWLQJLQPRYHPHQWGHIHFWVRU
SDUDO\VLV&RPSURPLVHGGHYHORSPHQWFDQDOVROHDGWRGHJHQHUDWLRQVLQFHWKHPRWRQHXURQLVQRWVHW
XSWRIXQFWLRQSURSHUO\/LWWOHLVNQRZQKRZHYHUUHJDUGLQJWKHPHFKDQLVPVWKDWFRQWUROYHUWHEUDWH
PRWRQHXURQGHYHORSPHQWSDUWLFXODUO\WKHODWHUVWDJHVRID[RQEUDQFKDQGGHQGULWHIRUPDWLRQ7KH
PRWRQHXURQGLVHDVHVSLQDOPXVFXODUDWURSK\60$LVFDXVHGE\ORZOHYHOVRIWKHVXUYLYDOPRWRU
QHXURQ601SURWHLQOHDGLQJWRGHIHFWVLQYHUWHEUDWHPRWRQHXURQGHYHORSPHQWDQGV\QDSVH
IRUPDWLRQ+HUHZHVKRZXVLQJ]HEUDILVKDVDPRGHOV\VWHPWKDW601LQWHUDFWVZLWKWKH51$ELQGLQJ
SURWHLQ5%3+X'LQPRWRQHXURQVLQYLYRGXULQJIRUPDWLRQRID[RQDOEUDQFKHVDQGGHQGULWHV7R
GHWHUPLQHWKHIXQFWLRQRI+X'LQPRWRQHXURQVZHJHQHUDWHG]HEUDILVKHuDPXWDQWVDQGIRXQGWKDW
WKH\H[KLELWHGGHFUHDVHGPRWRUD[RQEUDQFKHVGUDPDWLFDOO\IHZHUGHQGULWHVDQGPRYHPHQWGHIHFWV
7KHVHVDPHSKHQRW\SHVDUHSUHVHQWLQDQLPDOVH[SUHVVLQJORZOHYHOVRI601LQGLFDWLQJWKDWERWK
SURWHLQVIXQFWLRQLQPRWRQHXURQGHYHORSPHQW+X'ELQGVDQGWUDQVSRUWVP51$VDQGRQHRILWVWDUJHW
P51$VGap43LVLQYROYHGLQD[RQDORXWJURZWK:HIRXQGWKDWGap43ZDVGHFUHDVHGLQERWKHuD
DQGSMNPXWDQWV,PSRUWDQWO\WUDQVJHQLFH[SUHVVLRQRI+X'LQPRWRQHXURQVRISMNPXWDQWV
UHVFXHGWKHPRWRQHXURQGHIHFWVWKHPRYHPHQWGHIHFWVDQGGap43P51$OHYHOV7KHVHGDWD
VXSSRUWWKDWWKHLQWHUDFWLRQEHWZHHQ601DQG+X'LVFULWLFDOIRUPRWRQHXURQGHYHORSPHQWDQGSRLQWWR
DUROHIRU5%3VLQ60$
Ϯ
6LJQLILFDQFH6WDWHPHQW
,Q]HEUDILVKPRGHOVRIWKHPRWRQHXURQGLVHDVH60$PRWRUD[RQVIDLOWRIRUPWKHQRUPDOH[WHQWRID[RQDO
EUDQFKHVDQGGHQGULWHVOHDGLQJWRGHFUHDVHGPRWRUIXQFWLRQ60$LVFDXVHGE\ORZOHYHOVRIWKH601
SURWHLQ:HVKRZLQPRWRQHXURQVLQYLYRWKDW601LQWHUDFWVZLWKWKH51$ELQGLQJSURWHLQ5%3+X'
1RYHOPXWDQWVUHYHDOWKDW+X'LVDOVRQHFHVVDU\IRUPRWRUD[RQDOEUDQFKDQGGHQGULWHIRUPDWLRQ'DWDDOVR
UHYHDOHGWKDWERWK601DQG+X'DIIHFWOHYHOVRIDQP51$LQYROYHGLQD[RQDOJURZWK0RUHRYHUH[SUHVVLQJ
+X'LQ601GHILFLHQWPRWRQHXURQVFDQUHVFXHWKHPRWRQHXURQGHYHORSPHQWDQGPRWRUGHIHFWVFDXVHGE\
ORZOHYHOVRI6017KHVHGDWDVXSSRUWWKDW601+X'FRPSOH[HVDUHHVVHQWLDOIRUQRUPDOPRWRQHXURQ
GHYHORSPHQWDQGLQGLFDWHWKDWP51$KDQGOLQJLVDFULWLFDOFRPSRQHQWRI60$
ϯ
,QWURGXFWLRQ
1HXURQDOGHYHORSPHQWLVFRQWUROOHGDWPDQ\OHYHOV7KLVLQFOXGHVWUDQVFULSWLRQDOSURJUDPVWKDWGLFWDWHWKH
W\SHRIQHXURQ51$WUDQVSRUWIRUORFDOL]HG51$WUDQVODWLRQDQGGRZQVWUHDPSDWKZD\VLPSRUWDQWIRUWKH
IRUPDWLRQRIQHXURQDOVWUXFWXUHVQHFHVVDU\IRUWKHLUIXQFWLRQVXFKDVD[RQVGHQGULWHVDQGV\QDSVHV7KH
GLVUXSWLRQRIDQ\RIWKHVHVWHSVUHVXOWVLQDPRWRQHXURQWKDWHLWKHUGRHVQRWGHYHORSDWDOORURQHWKDW
GHYHORSVEXWGRHVQRWIXQFWLRQSURSHUO\)RUPRWRQHXURQVWKHLQLWLDOGHYHORSPHQWDOSURJUDPVWKDWGULYH
GLIIHUHQWLDWLRQDUHZHOOXQGHUVWRRG+RZHYHUPXFKOHVVLVNQRZQDERXWWKHODWHUVWHSVLQPRWRQHXURQ
GHYHORSPHQWWKDWHQFRPSDVVD[RQEUDQFKDQGGHQGULWHIRUPDWLRQ
:HKDYHSUHYLRXVO\VKRZQWKDWWKHVXUYLYDOPRWRUQHXURQ601SURWHLQLVUHTXLUHGIRUWKHVHODWHU
VWDJHVRIPRWRQHXURQGHYHORSPHQW8VLQJDJHQHWLF]HEUDILVKPRGHOH[SUHVVLQJQR]HEUDILVK601DQGRQO\
ORZOHYHOVRIKXPDQ601KHUHDIWHUUHIHUUHGWRDVmz-smnPXWDQWVZHIRXQGWKDWPRWRQHXURQVDUHERUQ
DQGWDNHRQWKHFRUUHFWIDWHVEXWIDLOWRIRUPUREXVWD[RQVZLWKWKHQRUPDOOHYHORIEUDQFKLQJDQGWKHLU
GHQGULWHVDUHUHGXFHGLQQXPEHUDQGOHQJWK+DROHHWDO:HDQGRWKHUVKDYHVKRZQWKDW
QHXURPXVFXODUMXQFWLRQIRUPDWLRQLVDOVRDIIHFWHGXQGHUFRQGLWLRQVRIORZ601.DUL\DHWDO%RRQHW
DO.RQJHWDO/LQJHWDO,QWKHFRQWH[WRIWKHGLVHDVHVSLQDOPXVFXODUDWURSK\60$
ZKLFKLVFDXVHGE\ORZOHYHOVRI601ZHKDYHK\SRWKHVL]HGWKDWWKLVDEQRUPDOGHYHORSPHQWJHQHUDWHVD
PRWRQHXURQWKDWZLOOHYHQWXDOO\IDLOWRIXQFWLRQ,QGHHG]HEUDILVKZLWKORZOHYHOVRI601DQGGHILFLHQW
PRWRQHXURQGHYHORSPHQWKDYHVLJQLILFDQWPRYHPHQWGHIHFWVVXSSRUWLQJWKDWWKH\DUHIXQFWLRQDOO\
FRPSURPLVHG+DROHHWDO2XUJRDOLVWRHOXFLGDWHKRZ601IXQFWLRQVLQPRWRQHXURQGHYHORSPHQW
DVDZD\WREHWWHUXQGHUVWDQGQRUPDOGHYHORSPHQWDQGWKHPRWRQHXURQGHIHFWVLQ60$
2QHLQGLFDWLRQRIKRZ601PD\EHDIIHFWLQJPRWRQHXURQGHYHORSPHQWKDVFRPHIURPVWXGLHV
UHYHDOLQJWKDW601LQWHUDFWVELRFKHPLFDOO\ZLWKDQXPEHURI51$ELQGLQJSURWHLQV5%3V)DOOLQLHWDO
2QHRIWKHVH5%3V+X'DPHPEHURIWKH(/$9IDPLO\RI51$ELQGLQJSURWHLQVLVH[SUHVVHGLQWKH
QHUYRXVV\VWHPVRRQDIWHUPRWRQHXURQVDUHERUQDQGLVWKRXJKWWRSOD\DUROHLQWKHLUGHYHORSPHQW5%3V
KDYHEHHQVKRZQWRIXQFWLRQLQWUDQVSRUWLQJP51$VWRD[RQVDQGGHQGULWHVGXULQJGHYHORSPHQWDQG
UHJHQHUDWLRQDIWHULQMXU\+ROWDQG6FKXPDQ+RUQEHUJDQG+ROW)RUH[DPSOHOLPLWLQJWKH
ϰ
DPRXQWRIWKH5%3=%3GHFUHDVHVWKHOHYHOVRID[RQDOP51$VDQGQHJDWLYHO\DIIHFWVUHJHQHUDWLRQDIWHU
LQMXU\'RQQHOO\HWDODQGPRXVHNQRFNGRZQRIWKH5%3,03UHVXOWHGLQGLVUXSWLRQRIFRPPLVVXUDO
D[RQSDWKILQGLQJLQYLYR3UHLWQHUHWDO/RFDOO\WUDQVODWHG51$VDIIHFWERWKD[RQDOEUDQFKLQJDQG
HORQJDWLRQRIUHJHQHUDWLQJD[RQVVXSSRUWLQJDFULWLFDOUROHIRU5%3VDQGWKHLUP51$FDUJRVLQUHJHQHUDWLRQ
DQGIXQFWLRQ'RQQHOO\HWDO5HFHQWO\DQDO\VLVLQFXOWXUHGSULPDU\PRXVHPRWRQHXURQVVKRZHGWKDW
601DQG+X'DIIHFWORFDOWUDQVODWLRQLQJURZWKFRQHV)DOOLQLHWDO'RQOLQ$VSHWDO7KHVH
VWXGLHVLQGLFDWHWKDW601PD\IDFLOLWDWH+X'ELQGLQJWRLWVWDUJHWP51$VXOWLPDWHO\DIIHFWLQJP51$
WUDQVSRUWLQWRD[RQV7KLVKDVQRWKRZHYHUEHHQWHVWHGLQYLYRLQGHYHORSLQJPRWRQHXURQV
7RHOXFLGDWHWKHIXQFWLRQRI601DQG+X'LQYLYRLQPRWRQHXURQGHYHORSPHQWZHKDYHWDNHQD
GLUHFWDSSURDFKWRDQDO\]H601+X'FRPSOH[HVLQYLYR%\SHUIRUPLQJPRWRQHXURQVSHFLILFELRFKHPLVWU\
ZHILQGWKDW601DQG+X'LQWHUDFWLQPRWRQHXURQVEXWRQO\GXULQJSKDVHVRIUREXVWPRWRQHXURQ
GHYHORSPHQW:HJHQHUDWHGHuDPXWDQWVDQGILQGWKDWWKH\H[KLELWGHIHFWVVLPLODUWRDQLPDOVH[SUHVVLQJ
ORZOHYHOVRI601VXSSRUWLQJDUROHIRUWKHVHSURWHLQVLQPRWRQHXURQGHYHORSPHQW:HDOVRDQDO\]HG
JURZWKDVVRFLDWHGSURWHLQ*DSDSURWHLQLQYROYHGLQD[RQDORXWJURZWKGXULQJGHYHORSPHQWDQG
UHJHQHUDWLRQZKRVHP51$LVDWDUJHWRI+X':HIRXQGWKDWGap43P51$OHYHOVZHUHGHFUHDVHGLQERWK
HuDDQGmz-smnPXWDQWV0RUHRYHUWKHPRWRQHXURQGHYHORSPHQWDOGHIHFWVWKHPRYHPHQWGHIHFWVDQG
WKHGHFUHDVHGGap43P51$OHYHOVLQ601PXWDQWVZHUHDOOUHVFXHGE\H[SUHVVLQJ+X'LQWKHLU
PRWRQHXURQV7RJHWKHUWKHVHGDWDVXSSRUWDNH\UROHIRU601+X'DQGP51$KDQGOLQJLQPRWRQHXURQ
GHYHORSPHQWDQGVXJJHVWWKDWGLVUXSWLQJWKHLQWHUDFWLRQEHWZHHQWKHVHWZRSURWHLQVFDQFDXVH60$
SKHQRW\SHV
ϱ
0DWHULDOVDQG0HWKRGV
=HEUDILVKPDLQWHQDQFH
=HEUDILVKXVHGLQWKLVVWXG\ZHUHRQWKH$%7/7XSIHOORQJILQEDFNJURXQGsmnY262stopPXWDQWV
smn1fh229%RRQHWDODQGWKHJHQHUDWLRQRImz-smnPXWDQWVKDYHEHHQGHVFULEHGSUHYLRXVO\
+DROHHWDO$GXOW]HEUDILVKDQGHPEU\RVZHUHNHSWDWWHPSHUDWXUHVEHWZHHQƒ&DQG
PDLQWDLQHGE\VWDQGDUGSURWRFROV:HVWHUILHOG
*HQHUDWLRQRI+X'PXWDQWILVKXVLQJ&5,635&DV
7ZRGLIIHUHQWJXLGH51$VZHUHGHVLJQHGDQGXVHGWRWDUJHW]HEUDILVK+X'H[RQXVLQJSURWRFROV
EDVHGRQ7DOERWDQG$PDFKHU7DOERWDQG$PDFKHUIRUPXWDJHQHVLVJXLGH51$VZHUH
FRLQMHFWHGZLWKQXFOHDUORFDOL]HG&DV-DRHWDO
+X'WDUJHWWDUJHWHGWRWKHVHTXHQFH&$$&&7&$7&*7&$$&7$&&7*DWWKHHQGRI+X'H[RQ
:HGHVLJQHGDJXLGHROLJRVHTXHQFHLQFOXGLQJD&DVELQGLQJVFDIIROG&5,635WDUJHWDQG7
SURPRWHU
$$$*&$&&*$&7&**7*&&$&77777&$$*77*$7$$&**$&7$*&&77$7777$$&77*&7$777
&7$*&7&7$$$$&&$7&*7&$$&7$&&7*&&&&7$7$*7*$*7&*7$77$&*&
+X'WDUJHWWDUJHWHGWR&$$$&7&&*&&$&$*&&$$&DWWKHEHJLQQLQJRI+X'H[RQ$JXLGH
ROLJRVHTXHQFHLQFOXGLQJD&DVELQGLQJVFDIIROG&5,635WDUJHWDQG7SURPRWHUZDVGHVLJQHGDV
IROORZV
$$$*&$&&*$&7&**7*&&$&77777&$$*77*$7$$&**$&7$*&&77$7777$$&77*&7$777
&7$*&7&7$$$$&&&$&$*&&$$&**$&&&7&&7$7$*7*$*7&*7$77$&*&7KHVHV\QWKHWLF
VLQJOH'1$VWUDQGVZHUHDPSOLILHGXVLQJROLJRV*&*7$$7$&*$&7&$&7$7$*DQG
$$$*&$&&*$&7&**7*&&$&DQGWKHSURJUDPÛ&IRUPLQXWHÛ&VHFÛ&VHF
Û&VHFIRUWLPHVÛ&IRUPLQXWHV7KHES3&5SURGXFWZDVSXULILHGRQDJDURVH
JHO3&5SURGXFWZDVXVHGWRV\QWKHVL]HWKLVJ51$XVLQJ0D[LVFULSW7NLW´/LIH7HFK
ϲ
)RU&5,635PXWDJHQHVLVCas9P51$ZDVV\QWKHVL]HGIURPS&6Q&DVQ-DRHWDO
XVLQJP0HVVDJHP0DFKLQH6SNLW/LIH7HFK7KHJ51$QJ—ODQGcas9 P51$QJ—OZHUH
PL[HGWRJHWKHUDQGQOZDVLQMHFWHGLQWRFHOOVWDJHHPEU\RV,QMHFWHGHPEU\RVZHUHUDLVHGIRU
PRQWKVDQGRXWFURVVHGWRZLOGW\SHILVKIRUVFUHHQLQJ(PEU\RVZHUHVFUHHQHGXVLQJ+LJK5HVROXWLRQ
0HOW$QDO\VLV+50$'DKOHPHWDORQ&);PDFKLQH%LR5DG+50$SULPHUVIRUVFUHHQLQJ
DQGJHQRW\SLQJ+X'WDUJHWZHUH+X'B+50B(B)7&$&&&$7*&$*$&&DQG+X'B+50B(B5
*$&7&*$7&7&$&&$$7*+50$SULPHUVIRUVFUHHQLQJDQGJHQRW\SLQJ+X'WDUJHWZHUH
+X'B+50B(B)7$$7&$*&$$&$7**$*&&7&$*DQG+X'B+50B(B5
7*$**77**7&77*&7*7&$7&6DPSOHVZHUHUXQXVLQJÛ&PLQVÛ&VHFÛ&‚VHF
Û&VHF[Û&VHFÛ&VHF$PSOLILFDWLRQDQGPHOWFXUYHVZHUHDQDO\]HGXVLQJ
3UHFLVLRQ0HOW$QDO\VLVVRIWZDUH%LR5DG+HWHUR]\JRWHVDPSOHVZLWKGHIOHFWLRQVZHUHVHOHFWHGIRU
VHTXHQFLQJ3ULPHUVIRUVHTXHQFLQJ+X'WDUJHWZHUH+X'B6HTB(B)
&$&*7&&77&$$&7&*7&7777*DQG
+X'B6HTB(B5&&7*7*$7777*7&7&*$$&&$*3ULPHUIRUVHTXHQFLQJ+X'WDUJHWZHUH
+X'B6HTB(B)77$&**7***7*7*&$$*$$7&DQG+X'B6HTB(B5
7&7&$&&$$7*&7*&&$$$*$*,QMHFWHG)ILVKFDUU\LQJPXWDWLRQVZHUHFURVVHGWRZLOGW\SHILVK
WRUDLVHOLQHV)ILVKZHUHUDLVHGDQGVHTXHQFHGWRFRQILUPWKHPXWDWLRQEHIRUHJHQHUDWLQJ)PXWDQW
OLQHV6XEVHTXHQWJHQHUDWLRQVRIERWKKHWHUR]\JRXVDQGKRPR]\JRXVDQLPDOVZHUHJHQRW\SHGE\
+50$7KLVZDVSRVVLEOHLQWKHKRPR]\JRWHVEHFDXVHWKHESOHVLRQFUHDWHVDGLVWLQFWLYHPHOWFXUYH
WKDWFOHDUO\GLIIHUHQWLDWHVLWIURPKHWHUR]\JRWHVRUZLOGW\SHV
+X'KRPR]\JRXVPXWDQWVZHUHYLDEOHEXWQRWYHU\JRRGEUHHGHUV$IWHUYHULILFDWLRQRIWKH
PRWRQHXURQSKHQRW\SHLQDOORIWKHPXWDQWOLQHV+X'WDUJHWPXWDQWVZLWKWKHESLQVHUWLRQZHUH
XVHGIRUDOOH[SHULPHQWVLQWKLVSDSHUhudos55
6FRULQJHPEU\RVEDVHGRQPRWRUD[RQGHIHFWVDWaKSI
ϳ
(PEU\RVZHUHIL[HGDWaKSI,IQRWH[SUHVVLQJTg(mnx1:GFP),WKH\ZHUHSURFHVVHGIRU]QS
V\QDSWRWDJPLQDQWLERG\ODEHOLQJDVGHVFULEHGEHORZ(PEU\RWUXQNVZHUHPRXQWHGODWHUDOO\EHWZHHQ
WZRFRYHUVOLSV0RWRUD[RQVIURPKHPLVHJPHQWVD[RQVRQHSHUKHPLVHJPHQWZHUH
DQDO\]HG%DVHGRQPRWRUD[RQGHIHFWVHPEU\RVZHUHSODFHGLQRQHRIIRXUFDWHJRULHVVHYHUH
PRGHUDWHPLOGRUQRGHIHFWVDVSUHYLRXVO\GHVFULEHG&DUUHOHWDO(PEU\RVZLWKDWOHDVWIRXU
VHYHUHPRWRUD[RQGHIHFWVWUXQFDWLRQVRUH[FHVVLYHO\EUDQFKHGDWWKHWUXQFDWLRQRUJUHDWHUWKDQIRXU
PRGHUDWHPXWDWLRQVH[FHVVLYHO\EUDQFKHGELIXUFDWLQJLQQHUYDWLQJQHLJKERULQJP\RWRPHZHUH
FDWHJRUL]HGDV³VHYHUH´(PEU\RVZLWKDWOHDVWIRXUPRGHUDWHPRWRUD[RQGHIHFWVWZRVHYHUHGHIHFWV
RUJUHDWHUWKDQIRXUPLOGGHIHFWVVRPHHFWRSLFEUDQFKHVEXWQRUPDOOHQJWKDQGPRUSKRORJ\D[RQV
ODFNLQJSHUIHFWPRUSKRORJ\EXWQRH[FHVVLYHEUDQFKHVZHUHFDWHJRUL]HGDV³PRGHUDWH´(PEU\RVZLWK
DWOHDVWWZRPLOGGHIHFWVRURQHPRGHUDWHGHIHFWZHUHFDWHJRUL]HGDV³PLOG´DQGHPEU\RVFDWHJRUL]HG
DV³QRGHIHFWV´KDGPRWRUD[RQVLQGLVWLQJXLVKDEOHIURPZLOGW\SHV)RUHDFKH[SHULPHQWaHPEU\RV
ZHUHVFRUHGIURPWKUHHVHSDUDWHFOXWFKHV0HDQ“6(0RIWKHH[SHULPHQWVZHUHSORWWHGDQG
VWDWLVWLFVSHUIRUPHGXVLQJWKH0DQQ:KLWQH\QRQSDUDPHWULFUDQNWHVW
*HQHUDWLRQRIWUDQVJHQLFTg(Mnx1:Gal4)
7RJHQHUDWHWUDQVJHQLFOLQHVH[SUHVVLQJ*DOLQPRWRQHXURQVWKHSODVPLGmnx1-3 X 125bp:Gal4VP16 SODVPLG=HOHQFKXNDQG%UXVHVZDVFRLQMHFWHGZLWK7ROP51$ILQDOFRQFHQWUDWLRQ
QJ—O'1$DQGQJ—OP51$LQWRFHOOVWDJHHPEU\RV,QMHFWHGILVKZHUHUDLVHGWRDGXOWKRRG
RXWFURVVHGWRZLOGW\SHVDQG)VVFUHHQHGIRUWKHWUDQVJHQHXVLQJ3&53&5SULPHUV
**$$*&77$7*$$*&7$&7*7&77&7$7&DQG$$**$7&&$&$7$7&&$*$*&*&&*7$**)V
WKDWUHVXOWHGLQSRVLWLYH)VZHUHXVHGWRJHQHUDWHOLQHV3RVLWLYH)WUDQVJHQLFILVKZHUHFRQILUPHG
E\3&5DVDGXOWVILQFOLSDQGFURVVHGLQWRHuDDQGmz-smnPXWDQWV/LQHGHVLJQDWLRQTg(mnx13X125:Gal4-VP16)os57
*HQHUDWLRQRIWUDQVJHQLFTg(UAS:mCherry-HuD) RQHuDDQGmz-smn-EDFNJURXQGV
ϴ
;8$6IURP;8$6*)3SODVPLG%LVZDVHWDOZDV3&5DPSOLILHGXVLQJSULPHUV
$7$*$*&7&7*&$**7&**$*7$&7*7&&DQG$7*&**&&*&*&7$*&&$$77&&&7$77&7KH
3&5SURGXFWZDVGLJHVWHGZLWK6DF,DQG1RW,DQGFORQHGLQWRDS%OXH6FULSWZLWKWZR6FH,VLWHV
P&KHUU\+X'IURPFORQWHFK&YHFWRU)DOOLQLHWDOZDV3&5DPSOLILHGXVLQJ
$7*&**&&*&$7**7*$*&$$***&*$**DQG&*&7*&**&&*&77$$*$7$&$77*$7*$*
SULPHUV7KHUHVXOWLQJ3&5SURGXFWZDVGLJHVWHGZLWK1RW,DQGFORQHGLQWRWKHS%OXH6FULSWZLWK;
8$6WRJHQHUDWHS%OXH6FULSW;8$6P&KHUU\+X'SODVPLG7KLVSODVPLGZDVFRLQMHFWHGZLWK6FH,
HQ]\PHLQWRTg(mnx1:Gal4):mz-smn-/- DQGTg(mnx1:Gal4):HuD-/- HPEU\RVDWWKHFHOOVWDJH ,QMHFWHG
HPEU\RVWKDWKDGP&KHUU\H[SUHVVLRQLQPRWRQHXURQVDWKSIZHUHUDLVHGWRDGXOWKRRG)
WUDQVJHQLFVIURPWKHVH)ILVKZHUHXVHGIRUUHVFXHDQGEHKDYLRUH[SHULPHQWV *HQRW\SHZDV
FRQILUPHGE\3&5RU+50$/LQHGHVLJQDWLRQTg(5XUAS:mCherry-HuD)os58
*HQHUDWLRQRIWUDQVJHQLFTg(mnx1:mCherry-HuD)
mCherry-HuDIURPFORQWHFK&YHFWRU)DOOLQLHWDOZDV3&5DPSOLILHGXVLQJ
$7*&**&&*&$7**7*$*&$$***&*$**DQG&*&7*&**&&*&77$$*$7$&$77*$7*$*
SULPHUV7KLV3&5SURGXFWZDVGLJHVWHGZLWK1RW,DQGFORQHGLQWRWKHS%OXH6FULSWFRQWDLQLQJWKH
]HEUDILVKmnx1SURPRWHU+DROHHWDO,QMHFWHGHPEU\RVWKDWKDGP&KHUU\H[SUHVVLRQLQ
PRWRQHXURQVDWKSIZHUHUDLVHGWRDGXOWKRRG)WUDQVJHQLFVIURPWKHVH)ILVKZHUHFURVVHGWR
mz-smnPXWDQWIRUUHVFXHH[SHULPHQWV/LQHGHVLJQDWLRQTg(mnx1:mCherry-HuD)os59
*HQHUDWLRQRITg(mnx1:RFP-SMNE134K) DQGTg(mnx1:RFP-SMNQ282A) WUDQVJHQLFV
6LWHGLUHFWHGPXWDWLRQV(.DQG4$ZHUHLQWURGXFHGLQWRKXPDQSMNIXOOOHQJWKFRQVWUXFW
mnx1:hs:RFP-SMNXVLQJ$JLOHQWQuikChange,,SiteDirected Mutagenesis.LW$JLOHQW&DWDORJ
Mnx1:hs:RFP-SMNFRQVWUXFWSODVPLGZDVSUHYLRXVO\GHVFULEHG+DROHHWDO
3ULPHUVIRU(.PXWDJHQHVLVZHUH
*7**777$&$&7**$7$7**$$$7$*$$$**$*&$$$$7&7*DQG
ϵ
&$*$7777*&7&&777&7$777&&$7$7&&$*7*7$$$&&$&3ULPHUVIRU4$PXWDJHQHVLV
ZHUH&7**&7$77$7$7***777&$*$*&$$$7&$$$$$*$$**DQG
&&77&77777*$777*&7&7*$$$&&&$7$7$$7$*&&$*'1$SODVPLGVZHUHFRLQMHFWHGZLWK
6FH,LQWRFHOOVWDJHHPEU\RVDVSUHYLRXVO\GHVFULEHG+DROHHWDO/LQHGHVLJQDWLRQ
Tg(mnx1:1.5hsp70:RFP-SMNE134K)os60DQGTg(mnx1:1.5hsp70:RFP-SMNQ282A)os61
,PPXQRSUHFLSLWDWLRQ
WZRGD\HPEU\RVZHUHFROOHFWHGDQGSODFHGLQDSHWULGLVKFRQWDLQLQJPOLFHFROG3%6
(PEU\RVZHUHSLSHWWHGXSDQGGRZQVHYHUDOWLPHVWRUHPRYH\RONVDQGKHDGV7KHWUXQNVZHUH
WUDQVIHUUHGWRDP/JODVVKRPRJHQL]HU(PEU\RVZHUHKRPRJHQL]HGLQP/O\VLVEXIIHUP07ULV
S+P01D&O7ULWRQ;P0('7$P0306)LQ,VRSURSDQRODQGWDEOHWRI
5RFKH3URWHDVH,QKLELWRUSHUP/6DPSOHVZHUHWKHQFHQWULIXJHGIRUPLQXWHVDWJDW&
—ORIVXSHUQDWDQWZDVVDYHGIRUZHVWHUQEORWDQDO\VLV7KHUHPDLQLQJVXSHUQDWDQWZDVWUDQVIHUUHG
WRDFOHDQWXEHFRQWDLQLQJ—ORI$QWL5)3P$E0DJQHWLF%HDGV0%/FDW06DPSOHV
ZHUHURWDWHGRYHUQLJKWDW&6DPSOHVZHUHWKHQSODFHGRQWRDPDJQHWLFEDUIRUPLQXWHV
6XSHUQDWDQWZDVUHPRYHG%HDGVZHUHZDVKHG;LQZDVKEXIIHUP07ULVS+P01D&O
7ULWRQ;%HDGVZHUHWKHQERLOHGLQ;6'6EXIIHUP07ULVS+6'6
%URPRSKHQRO%OXHJO\FHUROP0'77WRHOXWHVDPSOHV
:KROHPRXQW,PPXQRIOXRUHVFHQFHVWDLQLQJ
7KLVSURWRFROLVEDVHGRQ+DROHHWDO%ULHIO\]HEUDILVKHPEU\RVRUODUYDHZHUHDQHVWKHWL]HG
ZLWKWULFDLQH6LJPD$DQGWKHQIL[HGLQSDUDIRUPDOGHK\GHLQ3%6RYHUQLJKWDWƒ&7KH
HPEU\RVZHUHWKHQZDVKHGLQ;3%6IRUPLQGLVWLOOHG+2IRUPLQIROORZHGE\DPLQ
LQFXEDWLRQDWURRPWHPSHUDWXUHZLWKíƒ&DFHWRQH(PEU\RVZHUHWKHQZDVKHGZLWKGLVWLOOHG+2IRU
PLQDQGWKHQLQFXEDWHGRYHUQLJKWDWƒ&ZLWK]QSV\QDSWRWDJPLQ'HYHORSPHQWDO6WXGLHV
+\EULGRPD%DQN8QLYHUVLW\RI,RZDGLOXWHGRUDFHW\ODWHGWXEXOLQ/LIHWHFKQRORJLHVGLOXWHGLQ
ϭϬ
LQ3%'7EXIIHU'062%6$7ULWRQ;DQGQRUPDOJRDWVHUXP
6DPSOHVZHUHZDVKHGîPLQZLWK3%67DWURRPWHPSHUDWXUHDQGLQFXEDWHGRYHUQLJKWDWƒ&ZLWK
$OH[D)OXRUJRDWDQWLPRXVH,J*/LIHWHFKQRORJLHV2586$GLOXWHGLQ3%'7DQG
QRUPDOJRDWVHUXP6DPSOHVZHUHZDVKHGIRUîPLQLQ3%67PRXQWHGRQDVOLGHZLWK3UR/RQJ
*ROGDQWLIDGHUHDJHQW/LIHWHFKQRORJLHV2586$DQGLPDJHVFDSWXUHGZLWKD/HLFD7&66/
VFDQQLQJFRQIRFDOPLFURVFRSHV\VWHP0RWRUD[RQVZHUHVFRUHGDVSUHYLRXVO\GHVFULEHG&DUUHOHWDO
:HVWHUQ%ORWDQDO\VLV
7KLVSURWRFROLVEDVHGRQ+DROHHWDO%ULHIO\WKUHH]HEUDILVKHPEU\RVZHUHSODFHGLQȝO
EOHQGLQJEXIIHUPP7ULVS+PP('7$DQG6'6DQGERLOHGIRUPLQ6DPSOHV
ZHUHWKHQGLOXWHGZLWKDQHTXDOYROXPHRI;6'6ORDGLQJEXIIHUPP7ULVS+6'6
%URPRSKHQRO%OXHJO\FHURODQGPPGLWKLRWKUHLWRODQGERLOHGIRUPLQ$WKLUGRIHDFK
VDPSOHIURPWKUHHHPEU\RVaȝJZHUHUHVROYHGRQDSRO\DFU\ODPLGHJHO7KHJHOZDV
HOHFWURWUDQVIHUHGWR$PHUVKDP+\ERQG339')PHPEUDQH*(+HDOWKFDUH0HPEUDQHVZHUH
SUREHGZLWK601PRXVHPRQRFORQDODQWLERG\(IURP'U*OHQQ0RUULVDQWLEDFWLQ6DQWD&UX]
%LRWHFKQRORJ\RUDQWL+X'(6DQWD&UX]%LRWHFKQRORJ\6LJQDOZDVGHWHFWHGZLWK
KRUVHUDGLVKSHUR[LGDVHFRQMXJDWHGJRDWDQWLPRXVHDQWLERG\-DFNVRQ,PPXQR5HVHDUFK
/DERUDWRULHV,QF(&/UHDJHQWVDQG$PHUVKDP+\SHUILOP(&/$PHUVKDP%LRVFLHQFH
)RUWKHKHDWVKRFNH[SHULPHQWVRUKSIHPEU\RVZHUHWUDQVIHUUHGWRDPOHSSHQGRUI
WXEHFRQWDLQLQJILVKZDWHUHPEU\RVWXEHDQGSODFHGLQDƒ&ZDWHUEDWKIRURQHKRXU:HVWHUQ
EORWVZHUHSHUIRUPHGKRXUVSRVWKHDWVKRFN
6LQJOHFHOOLQMHFWLRQDQGWUDFLQJ
7KLVSURWRFROLVEDVHGRQ+DROHHWDO%ULHIO\'1$SODVPLGmnx1:0.6hsp70:GFP'DOJLQHW
DOZDVSUHSDUHG4LDJHQ3ODVPLG0LQLNLWDQGGLOXWHGWRQJȝOLQ,6FH,EXIIHUFRQWDLQLQJ
ϭϭ
PP7ULV±+&OPPGLWKLRWKUHLWROPP0J&OS+XQLWVRI6FH,HQ]\PH1HZ(QJODQG%LRODE
DQGSKHQROUHG'1$QJȝOZDVLQMHFWHGLQWRHPEU\RVDWWKHHDUO\RQHFHOOVWDJHWRRI
WKHYROXPHRIWKHFHOODSSUR[LPDWH\QO,QMHFWHGHPEU\RVZHUHWUDQVIHUUHGLQWRILVKZDWHUFRQWDLQLQJ
SHQLFLOOLQVWUHSWRP\FLQ,QYLWURJHQ,QMHFWHGILVKZHUHVFUHHQHGIRU*)3H[SUHVVLQJ&D3PRWRU
QHXURQVDWKSI
$WRUGD\VSRVWIHUWLOL]DWLRQGSIHPEU\RVZHUHIL[HGLQSDUDIRUPDOGHK\GHLQ3%6DQG
'062RYHUQLJKWDWƒ&IROORZHGE\VWRUDJHLQ3%6,PDJHVZHUHFDSWXUHGZLWKWKH/HLFD7&66/
VFDQQLQJFRQIRFDOPLFURVFRSHV\VWHP7KHPRWRUD[RQEUDQFKHVDWGSIDQGPRWRQHXURQGHQGULWHV
DWGSIZHUHLPDJHGXVLQJFRQIRFDOPLFURVFRS\;REMHFWLYH$[RQVZHUHPHDVXUHGDWGSI
EHFDXVHWKHEUDQFKHVLQZLOGW\SHODUYDHDWGSIEHFRPHGLIILFXOWWRWUDFHGXHWRWKHLULQFUHDVHG
FRPSOH[LW\,PDJHVZHUHWUDFHGDQGPHDVXUHGXVLQJ1,+VRIWZDUH,PDJH-)LML$OOLPDJHVZHUHVHW
XSDVîSL[HOV7KHPLFURVFRSHFDOLEUDWLRQLQIRUPDWLRQ—PSL[HOZDVXVHGWRFRQYHUWWKH
,PDJH-PHDVXUHPHQWVSL[HOWRPLFURQV7KHDFWXDOVL]HRIWKHLPDJHVIRUPRWRUD[RQEUDQFKHVDW
GSIZDVî—P—PSL[HODQGIRUPRWRQHXURQGHQGULWHVDWGSIZDVî—P
—PSL[HO(DFKSORWZDVIURPWRLQGLYLGXDOGHQGULWHVRUD[RQEUDQFKHVIURP
ODUYDHDQGUHSRUWHGDVPHDQ“6'
=HEUDILVKPRWRUEHKDYLRUV
%HKDYLRUDOH[SHULPHQWVZHUHSHUIRUPHGRQGSIODUYDHDWƒ&/DUYDHZHUHSUHDGDSWHGWRWKH
WHVWLQJDUHQDIRUPLQXWHV[JULGRUKRXUVFPSHWULGLVK/DUYDOEHKDYLRUZDVFDSWXUHGZLWK
DQ,'70RWLRQ3UR<YLGHRFDPHUDDQGDQDO\]HGZLWKWKH)/27(VRIWZDUHSDFNDJHDVSUHYLRXVO\
GHVFULEHG%XUJHVVDQG*UDQDWRED)UDPHE\IUDPH)/27(WUDFNVODUYDOERG\SRVLWLRQDQG
FRQIRUPDWLRQWKHQSHUIRUPVDXWRPDWHGDQDO\VLVRIERG\FXUYDWXUHFKDQJHVWRH[WUDFWNLQHPDWLFGHWDLOV
RIVZLPPLQJDQGWXUQLQJPRYHPHQWV%DVHGRQGHILQHGNLQHPDWLFSDUDPHWHUVWKDWGLVWLQJXLVK
GLVFUHWHPRWRUEHKDYLRUV)/27(FODVVLILHVHDFKPRYHPHQWDVDGLVWLQFWIRUPRIDWXUQRUVZLP7R
HYDOXDWHQRQHYRNHGJURVVPRYHPHQWRYHUWLPHODUYDHZHUHLQGLYLGXDOO\KRXVHGLQD[JULG
ϭϮ
:ROPDQHWDODQGWKHLUSRVLWLRQZDVUHFRUGHGDWIUDPHVSHUVHFRQGRYHUDFRQWLQXRXV
VHFRQGSHULRG7KH1SHUH[SHULPHQWDOJURXSUDQJHGIURPODUYDH7RH[DPLQHQRQHYRNHG
VZLPDQGWXUQLQLWLDWLRQVDQGVZLPPLQJSHUIRUPDQFHODUYDHRILGHQWLFDOJHQRW\SHZHUHJURXSHGLQ
DFPZLGHSHWULGLVKDQGGLVKHVZHUHWHVWHGSHUJHQRW\SH)RUWKLVDQDO\VLVZHUHFRUGHGDW
IUDPHVSHUVHFRQGIRUVHFRQGDWVHFRQGLQWHUYDOVWRFDSWXUHDWRWDORIWULDOVRIVHFRQG
UHFRUGLQJV)RUHDFKUHFRUGLQJ)/27(GHWHUPLQHGLIHDFKODUYDLQLWLDWHGDWXUQVZLPRUUHPDLQHG
VWDWLRQDU\RQO\WKHILUVWPRYHPHQWW\SHLQHDFKVHFRQGUHFRUGLQJZDVVFRUHG7KHPHDQIUHTXHQF\
LQZKLFKDODUYDLQLWLDWHGDWXUQRUVZLPZLWKLQDVHFRQGUHFRUGLQJSHULRGZDVSORWWHG7RHYDOXDWH
VZLPPLQJSHUIRUPDQFHZHDQDO\]HGNLQHPDWLFSDUDPHWHUVRIVORZ³VFRRW´VZLPVWKDWLQFOXGHGWZRRU
PRUHVZLPKDOIF\FOHV$KDOIVZLPF\FOHLVGHILQHGE\DVLQJOHOHIWZDUGRUULJKWZDUGWDLOXQGXODWLRQ$OO
VWDWLVWLFVIRUWKHEHKDYLRUDOGDWDZDVDQDO\]HGE\DRQHZD\$129$ZLWKD%RQIHUURQLSRVWKRFWHVW
IRUVLJQLILFDQFHDQGDUHQRWHGLQWKHILJXUHOHJHQG
'LJLWDOGURSOHW3&5GG3&5IRUGap43 P51$DQDO\VLV
:LOGW\SHHuDmz-smnTg(mnx1:Gal4);Tg(UAS:mCherry-HuD);mz-smn-DQG
Tg(mnx1:Gal4);Tg(UAS:mCherry-HuD);HuDILVKZHUHVHWXSLQWRJURXSFURVVHVVHWVRIJURXS
FURVVHVIRUHDFKJHQRW\SH)RUHDFKJHQRW\SHHPEU\RVZHUHFROOHFWHGFRPELQLQJHPEU\RVIURP
WKHWKUHHGLIIHUHQWJURXSFURVVHV$WGSIHPEU\RVZHUHGHFKRULRQDWHGDQGWUDQVIHUUHGLQWRSHWUL
GLVKHVFRQWDLQLQJPO3%6DQG7ULFDLQH6LJPD+HDGVDQG\RONVZHUHUHPRYHGXVLQJIRUFHSV
DQGWKHWUXQNVZHUHWUDQVIHUUHGWRPOHSSHQGRUIWXEHV51$ZDVLVRODWHGXVLQJ7UL]RO,QYLWURJHQ
DQGWUHDWHGZLWK3URPHJD54'1DVH3URPHJDF'1$ZDVPDGHIURPQJRI51$XVLQJL6FULSW
F'1$V\QWKHVLVNLW%LR5DG7KHF'1$ZDVGLOXWHGWRDQHTXLYDOHQWRIDQGQJ51$IRUWKH
TXDQWLILFDWLRQRIWUDQVFULSWVXVLQJGG3&5%LR5DG,\HUHWDOGG3&5ZDVSHUIRUPHGLQ
WULSOLFDWHVIRUHDFKRIDQGQJ51$HTXLYDOHQWF'1$VDPSOHWRDVVD\IRUGAP43DJDLQVWWKH
QRUPDOL]LQJJHQHXELTXLWLQFRQMXJDWLQJHQ]\PH($Ube2a);XHWDO7KLVZDVSHUIRUPHG
WZLFHUHVXOWLQJLQWHFKQLFDOUHSOLFDWHV+RZHYHURQHGDWDSRLQWIRUHuD-/-ZDVVWDQGDUGGHYLDWLRQV
ϭϯ
IURPWKHPHDQRIWKHRWKHUGDWDSRLQWVDQGZDVWKXVUHPRYHGDVDQRXWOLHUUHVXOWLQJLQWKHHuD-/-
GDWDVHWFRQVLVWLQJRIQRWGDWDSRLQWV)RUGG3&5DERXWWHQWRIRXUWHHQWKRXVDQGGURSOHWVZHUH
JHQHUDWHGSHUVDPSOHZLWKWKHQHFHVVDU\3&5UHDJHQWV%LR5DGGG3&56XSHUPL[IRUSUREHVQR
G873SULPHUV,'7,QWHUJUDWHG'1$7HFKQRORJLHVDQGSUREH,'7DQGWKH3&5ZDVSHUIRUPHGDV
GHVFULEHG,\HUHWDO7KHIOXRUHVFHQFHVLJQDOLQWKHGURSOHWVZDVUHDGDQGTXDQWLWDWHG
DFFRUGLQJWR3RLVVRQVWDWLVWLFVXVLQJ4XDQWD6RIWVRIWZDUH%LR5DG7KHVHTXHQFHVRIWKHSULPHUV
DQGSUREHVZHUH
*$3SULPHUV¶&$&&$$*$7&&$**&&$*&77&&¶&$***7&&*&7*&$*&$*7*DQG
SUREH)$0¶&&*$&7*$&*&&7&&$&$*$$$&$&$*
8EHDSULPHUV¶*&7**$*7&&$$&$7$7*$&*777&&¶&$*7&$&*&&$*&7&7*77&&$&
DQGSUREH+(;¶$7*$*&&*$$&&&$$$&$*&&&7*&&
([SHULPHQWDO'HVLJQDQG6WDWLVWLFDO$QDO\VLV
=HEUDILVKHPEU\RVDQGODUYDHFDQQRWEHGHVLJQDWHGDVPDOHRUIHPDOH$OOH[SHULPHQWVZHUH
SHUIRUPHGRQHPEU\RVRUODUYDHIURPPXOWLSOHJURXSPDWLQJV7KHQXPEHURIH[SHULPHQWVDQGDQLPDOV
YDULHGGHSHQGLQJRQWKHH[SHULPHQWDQGLVWKHUHIRUHQRWHGLQWKHILJXUHOHJHQGV7KH9DVVHU6WDWV
VWDWLVWLFDOZHEVLWHKWWSYDVVDUVWDWVQHWRU6LJPD3ORWZDVXVHGWRSHUIRUPVWDWLVWLFDODQDO\VLV7KH
H[DFWWHVWVDQGSDUDPHWHUVDUHQRWHGLQWKHWH[WDQGILJXUHOHJHQGV
5HVXOWV
601LQWHUDFWVZLWK+X'LQPRWRQHXURQVGXULQJGHYHORSPHQW
6WXGLHVKDYHVKRZQWKDW601DQGWKHQHXURQVSHFLILF51$ELQGLQJSURWHLQ+X'LQWHUDFWELRFKHPLFDOO\LQ
FXOWXUHGSULPDU\FRUWLFDOQHXURQV$NWHQHWDO01FHOOV+XEHUVHWDODQGLQFXOWXUHGPRXVH
PRWRQHXURQVDQGUDWEUDLQH[WUDFW)DOOLQLHWDO+RZHYHUWKLVKDVQRWEHHQH[DPLQHGLQPRWRQHXURQ
LQYLYRGXULQJGHYHORSPHQWZKLFKKDVLPSOLFDWLRQVIRU60$7RWKLVHQGZHSHUIRUPHGPRWRQHXURQVSHFLILF
FRLPPXQRSUHFLSLWDWLRQFR,3H[SHULPHQWV7RVSHFLILFDOO\DQDO\]H601IURPPRWRQHXURQVLQYLYRZH
ϭϰ
WRRNDGYDQWDJHRIDWUDQVJHQLFOLQHZLWKPRWRQHXURQSURPRWHUmnx1DOVRNQRZDVhb9IURP]HEUDILVK
GULYLQJ5)3WDJJHGKXPDQ601)LJXUH$+DROHHWDOWKXVHQDEOLQJXVWRH[SUHVV5)3601LQ
PRWRQHXURQV8VLQJDQDQWL5)3DQWLERG\ZHLPPXQRSUHFLSLWDWHG5)3601IURPGD\SRVWIHUWLOL]DWLRQ
GSIHPEU\RVZKLFKLVDWLPHZKHQPRWRQHXURQVDUHIRUPLQJH[WHQVLYHD[RQEUDQFKHV:HIRXQGWKDW+X'
GLGFR,3ZLWK601)LJXUH%2WKHUVKDGVKRZQWKDW601DQG+X'LQWHUDFWYLDWKH601WXGRUGRPDLQ
DQGWKDWWKHKXPDQPXWDWLRQ601(.GLVUXSWHGWKH601+X'LQWHUDFWLRQ)DOOLQLHWDO+XEHUVHW
DO7KHUHIRUHZHJHQHUDWHGDWUDQVJHQLFOLQHZLWKWKHmnx1SURPRWHUGULYLQJ5)3601(.)LJ
$:HIRXQGWKDW601(.LQPRWRQHXURQVZDVQRWDEOHWRSUHFLSLWDWH+X'LQGLFDWLQJWKDWWKLVKXPDQ
PXWDWLRQGLVUXSWHGWKHLQWHUDFWLRQEHWZHHQ601DQG+X'LQYLYR:HDOVRJHQHUDWHGDWUDQVJHQLFOLQH
H[SUHVVLQJDFWHUPLQDOPXWDWLRQ6014$&DUUHOHWDO)LJ$7KLVPXWDWLRQGLGQRWGLVUXSWWKH
601+X'LQWHUDFWLRQVXSSRUWLQJWKHVSHFLILFLW\RIWKLVELRFKHPLFDODVVD\)LJ%
:HQH[WDVNHGZKHWKHUWKLVLQWHUDFWLRQEHWZHHQ601DQG+X'ZDVGHYHORSPHQWDOO\UHJXODWHG:H
KDGSUHYLRXVO\VKRZQXVLQJWKHTg(mnx1:RFP-SMN)OLQHWKDW601LVSUHVHQWLQPRWRUD[RQVZKHQWKH\DUH
XQGHUJRLQJUREXVWD[RQGHYHORSPHQWDQGEUDQFKLQJZKLFKLVHVVHQWLDOO\FRPSOHWHE\GSI+DROHHWDO
:HWKHUHIRUHDVNHGZKHWKHU601DQG+X'VWLOOFR,3DWGSI:HIRXQGWKDWDWWKLVWLPHWKH\GLG
QRWVXJJHVWLQJWKDWWKHLQWHUDFWLRQEHWZHHQ601DQG+X'LVGHYHORSPHQWDOO\UHJXODWHGDQGRFFXUVGXULQJ
WKHWLPHSHULRGDVVRFLDWHGZLWKD[RQEUDQFKGHYHORSPHQW)LJ%
601LVUHTXLUHGIRU+X'H[SUHVVLRQEXWRQO\HDUO\LQGHYHORSPHQW
6LQFH601DQG+X'IRUPDFRPSOH[LQPRWRQHXURQVZHZDQWHGWRDGGUHVVZKHWKHU601KDGDQHIIHFWRQ
+X'H[SUHVVLRQ$QXPEHURIVWXGLHVKDYHVKRZQWKDW601FDQUHJXODWHWKHOHYHOVRIRWKHUSURWHLQVVXFK
DVVRPHRIWKH*HPLQSURWHLQV)HQJHWDODQG3ODVWLQ%RZHUPDQHWDO+DROHHWDO
DQGWKDW601PD\IXQFWLRQLQWKHWUDQVODWLRQDOUHJXODWLRQRIPDQ\SURWHLQV6DQFKH]HWDO
7KHUHIRUHZHDQDO\]HGZKHWKHU601DIIHFWHG+X'SURWHLQOHYHOV)RUWKHVHH[SHULPHQWVZHXWLOL]HGmzsmnPXWDQWV,QFRQVWUXFWLQJWKLVOLQHZHFURVVHGLQWKH]HEUDILVKKVSSURPRWHUGULYLQJ5)3601
WUDQVJHQHTg(hsp70:RFP-SMN)RQWRmz-smnPXWDQWV8QGHUQRUPDOFRQGLWLRQVWKHVHILVKH[SUHVVORZ
ϭϱ
OHYHOVRI5)3601GXHWRWKHOHDN\KVSSURPRWHUDQGWKXVDUHDJHQHWLFPRGHORIVSLQDOPXVFXODU
DWURSK\DPRWRQHXURQGLVHDVHFDXVHGE\ORZOHYHOVRI601+DROHHWDO+DROHHWDO8VLQJ
WKLVOLQHZHDQDO\]HG+X'SURWHLQOHYHOVDQGIRXQGWKDWWKH\ZHUHGHFUHDVHG)LJ$%HFDXVHWKHVHILVK
FDUU\WKHTg(hsp70:RFP-SMN)WUDQVJHQHZHFDQKHDWVKRFNWKHPWRLQFUHDVH601OHYHOV+DROHHWDO
7RDGGUHVVZKHWKHUDGGLQJEDFN601ZRXOGOHDGWRDQLQFUHDVHLQ+X'ZHKHDWVKRFNHGDQLPDOV
DWDQGKSI,QWHUHVWLQJO\ZHIRXQGWKDWRQO\ZKHQZHKHDWVKRFNHGDQLPDOVDQGLQFUHDVHG601DW
KRXUVSRVWIHUWLOL]DWLRQKSIGLGZHVHHDQLQFUHDVHLQ+X'EXWQRWZKHQWKHKHDWVKRFNDQGLQFUHDVHG
601DWKSI)LJ$6XEMHFWLQJZLOGW\SHHPEU\RVWRKHDWVKRFNGLGQRWDIIHFW+X'OHYHOV)LJ%
7KHVHGDWDVXSSRUWWKDW601KDVDQHIIHFWRQ+X'OHYHOVWKDWLVGHYHORSPHQWDOO\UHJXODWHG
+X'PXWDQWVKDYHGHFUHDVHGD[RQDOEUDQFKHVDQGGHQGULWHV
7REHWWHUXQGHUVWDQGWKHIXQFWLRQRI+X'LQPRWRQHXURQGHYHORSPHQWZHJHQHUDWHG]HEUDILVKHuDPXWDQWV
XVLQJ&5,635&DV7DOERWDQG$PDFKHU8VLQJWZRVHSDUDWHJXLGH51$VZHJHQHUDWHGIRXU
XQLTXHHuDPXWDWLRQVWKDWUHVXOWHGLQQRHYLGHQFHRI+X'SURWHLQDVUHYHDOHGE\ZHVWHUQEORWVXSSRUWLQJ
WKDWWKHVHDUHQXOODOOHOHV)LJ$8QOLNH601%RRQHWDO+DROHHWDOZHGLGQRWVHH
HYLGHQFHRIDQ\PDWHUQDO+X'SURWHLQ7RH[DPLQHPRWRQHXURQGHYHORSPHQWLQHuDPXWDQWVZHH[DPLQHG
PRWRUD[RQVDWDQGGSIDQGGHQGULWHVDWGSI$WGSIZHIRXQGWKDWPRWRQHXURQVZHUHSUHVHQWEXW
WKH\GLGQRWH[WHQGD[RQVQRUPDOO\)LJ%'S0DQQ:KLWQH\QRQSDUDPHWULFUDQNWHVW$W
DQGGSIZHIRXQGWKDWWKHUHZHUHVLJQLILFDQWGHFUHDVHVLQD[RQDOEUDQFKHV)LJ(*SWZR
WDLOHG7WHVWRILQGHSHQGHQWVDPSOHV$WGSIPXWDQWVH[KLELWHGDVLJQLILFDQWGHFUHDVHLQGHQGULWLFEUDFKHV
LQHuD PXWDQWVFRPSDUHGWRZLOGW\SHV)LJSWZRWDLOHG7WHVWRILQGHSHQGHQWVDPSOHV
7KHVHSKHQRW\SHVZHUHYHU\VLPLODUWRWKRVHIRXQGLQmz-smnPXWDQWV+DROHHWDOVXJJHVWLQJWKDW
GHFUHDVLQJHLWKHU601RU+X'KDVDQHJDWLYHHIIHFWRQPRWRQHXURQGHYHORSPHQWUHVXOWLQJLQGHILFLHQW
PDWXUDWLRQRID[RQVDQGGHQGULWHV
+X'LVH[SUHVVHGLQQHXURQVWKURXJKRXWWKHFHQWUDODQGSHULSKHUDOQHUYRXVV\VWHP0DUXVLFKHWDO
7KHUHIRUHWKLVHIIHFWRQPRWRQHXURQGHYHORSPHQWFRXOGEHGXHWRORVVRI+X'LQFHOOVRWKHUWKDQ
ϭϲ
PRWRQHXURQV7RWHVWWKLVGLUHFWO\ZHPDGHDWUDQVJHQLFOLQHH[SUHVVLQJ+X'LQPRWRQHXURQVXVLQJWKH
Gal4:UASV\VWHP)RUWKLVZHJHQHUDWHGTg(mnx1:Gal4)DQGTg(UAS:mCherry-HuD)DQGFURVVHGWKHVH
RQWRWKH+X'PXWDQWOLQHVHHPHWKRGVIRUGHWDLOV:HIRXQGWKDWH[SUHVVLQJ+X'LQPRWRQHXURQVRQD
HuDPXWDQWEDFNJURXQGUHVFXHGWKHPRWRQHXURQGHYHORSPHQWDOGHIHFWDWKSI)LJSWZR
WDLOHG0DQQ:KLWQH\QRQSDUDPHWULFUDQNWHVWZWYHUVXVHuD-/-MN-HuD, S WZRWDLOHG0DQQ
:KLWQH\QRQSDUDPHWULFUDQNWHVW:HDOVRDQDO\]HGPRWRUD[RQVDWGSIDQGGHQGULWHVDWGSIDQGIRXQG
VLJQLILFDQWUHVFXHZKHQ+X'ZDVH[SUHVVHGMXVWLQPRWRQHXURQV)LJSWZRWDLOHG7WHVWRI
LQGHSHQGHQWVDPSOHVZWYHUVXVHuD-/-MN-HuDS IRUD[RQEUDQFKHVDQGS IRUGHQGULWHV
7KHVHGDWDVXSSRUWWKDW+X'DFWVFHOODXWRQRPRXVO\LQPRWRQHXURQVDQGLVHVVHQWLDOIRUWKHLUQRUPDO
GHYHORSPHQW:HKDGSUHYLRXVO\VKRZQWKDW601DOVRDFWVPRWRQHXURQFHOODXWRQRPRXVO\+DROHHWDO
LQGLFDWLQJWKDWWKHVHWZRSURWHLQVDUHERWKLQWHJUDOLQPRWRQHXURQVIRUWKHLUGHYHORSPHQW
+X'H[SUHVVHGLQmz-smnPRWRQHXURQVVLJQLILFDQWO\UHVFXHVWKHPRWRQHXURQGHYHORSPHQWDO
GHIHFWVDQGPRYHPHQWGHILFLWV
:HVKRZHGDERYHWKDWHuDDQGmz-smnPXWDQWVFDXVHDVLPLODUPRWRQHXURQSKHQRW\SHDQGWKDW
GHFUHDVLQJ601OHDGVWRGHFUHDVHG+X'OHYHOV7KHUHIRUHZHDVNHGZKHWKHUH[SUHVVLQJ+X'LQmz-smn
PRWRQHXURQVFRXOGFRPSHQVDWHDQGUHVFXHWKHPRWRQHXURQGHYHORSPHQWDOGHIHFWVFDXVHGE\ORZOHYHOVRI
601:HWHVWHGWKLVLQWZRZD\V)LUVWZHXVHGWKH*DO8$6V\VWHPDQGJHQHUDWHGTg(mnx1:Gal4)DQG
Tg(UAS:mCherry-HuD) OLQHVRQWKHmz-smnPXWDQWEDFNJURXQGVHHPHWKRGVIRUGHWDLOV:HDOVR
JHQHUDWHGDQRWKHUWUDQVJHQLFOLQHH[SUHVVLQJmCherry-HuDLQPRWRQHXURQVTg(mnx1:mCherry-HuD)DQG
FURVVHGWKHVHWRWKHmz-smnPXWDQWV%RWKWUDQVJHQLFOLQHVH[SUHVVHGOHYHOVRIP&KHUU\+X'FRPSDUDEOH
WRWKHOHYHOVRIHQGRJHQRXV+X'GDWDQRWVKRZQ8VLQJERWKDSSURDFKHVZHIRXQGWKDWH[SUHVVLQJ+X'
LQmz-smnPRWRQHXURQVVLJQLILFDQWO\UHVFXHGWKHPRWRUD[RQGHIHFWVFDXVHGE\ORZOHYHOVRI601:H
DQDO\]HGWKLVDWGSIDQGIRXQGVLJQLILFDQWUHVFXHEDVHGRQPRWRUD[RQGHIHFWV)LJSWZR
WDLOHG0DQQ:KLWQH\QRQSDUDPHWULFUDQNWHVW:HWKHQDQDO\]HGLQGLYLGXDOPRWRQHXURQVD[RQVDWGSI
DQGGHQGULWHVDWGSIXVLQJWKH*DO8$6V\VWHP)LJ$QDO\VLVDWWKHVLQJOHFHOOOHYHOUHYHDOHG
ϭϳ
VLJQLILFDQWUHVFXHIRUERWKD[RQDOEUDQFKHVDQGGHQGULWHVSIRUERWKD[RQEUDQFKHVDQG
GHQGULWHVWZRWDLOHG7WHVWRILQGHSHQGHQWVDPSOHV6HHILJXUHOHJHQGIRUDGGLWLRQDOVWDWLVWLFDODQDO\VLV
7KHVHGDWDUHYHDOWKDWH[SUHVVLQJ+X'LQ601GHILFLHQWPRWRQHXURQVFDQUHVFXHWKHGHYHORSPHQWDO
GHIHFWVREVHUYHGLQD[RQDOEUDQFKLQJDQGGHQGULWHIRUPDWLRQ$OWKRXJKZHIRXQGVWDWLVWLFDOO\VLJQLILFDQW
UHVFXHZLOGW\SHVZHUHVWDWLVWLFDOO\EHWWHUWKDQmz-smnDQLPDOVFDUU\LQJ01+X'IRUWKHVHSDUDPHWHUV
LQGLFDWLQJWKDWWKHUHVFXHZDVQRWFRPSOHWH
:HKDGSUHYLRXVO\VKRZQWKDWmz-smnODUYDHZHUHGHILFLHQWLQLQLWLDWLQJERXWVRIVSRQWDQHRXVVZLPV
DQGWXUQVGLVWDQFHPRYHGRYHUWLPHDQGSHUVZLPDQGRWKHUNLQHPDWLFSDUDPHWHUVRIVZLPPLQJWRJHWKHU
LQGLFDWLQJWKDWWKHPRWRQHXURQGHIHFWVKDGDQHJDWLYHLPSDFWRQPRWRUIXQFWLRQ+DROHHWDO:H
DVNHGWKHUHIRUHZKHWKHUGULYLQJ+X'LQmz-smnPRWRQHXURQVQRWRQO\UHVFXHGPRWRQHXURQGHYHORSPHQW
EXWFRXOGDOVRUHVFXHPRWRUEHKDYLRU7RPHDVXUHVSRQWDQHRXVPRYHPHQWVZHXVHGKLJKVSHHGYLGHR
FDSWXUHDQGDQDO\VLVRQGSIODUYDH:HILUVWDQDO\]HGJURVVPRYHPHQWRYHUDFRQWLQXRXVPLQXWHSHULRG
DQGIRXQGWKDWERWKmz-smnDQGHuDPXWDQWVPRYHGVLJQLILFDQWO\OHVVGLVWDQFHFRPSDUHGWRZLOGW\SH
ODUYDH)LJ$SRQHZD\$129$,PSRUWDQWO\H[SUHVVLQJ+X'LQPRWRQHXURQVVLJQLILFDQWO\
UHVFXHGWKHVHPRYHPHQWGHIHFWVLQERWKmz-smnDQGHuDPXWDQWVSRQHZD\$129$7R
GHWHUPLQHZKHWKHUWKHUHGXFHGRYHUDOOPRYHPHQWE\mz-smnDQGHuDPXWDQWVZDVGXHWRUHGXFHG
LQLWLDWLRQVRIPRYHPHQWZHDQDO\]HGWKHIUHTXHQF\RIVZLPDQGWXUQLQLWLDWLRQV$VZLWKWKHJURVV
PRYHPHQWLQLWLDWLRQIUHTXHQF\RIERWKVZLPVDQGWXUQVZDVGHFUHDVHGLQmz-smnDQGHuDPXWDQWV7KHVH
GHILFLHQFLHVZHUHVLJQLILFDQWO\UHVFXHGE\GULYLQJ+X'LQPRWRQHXURQV)LJ%&VHHILJXUHOHJHQGIRU
VWDWV7RORRNPRUHFORVHO\DWWKHUHVFXHLQmz-smnPXWDQWVZHDQDO\]HGNLQHPDWLFSDUDPHWHUVRIQRQ
HYRNHGVZLPPLQJHYHQWVWKDWLQFOXGHGWZRRUPRUHVZLPKDOIF\FOHVDVZLPKDOIF\FOHLQYROYHVDVLQJOH
XQLODWHUDOERG\EHQG:HIRXQGWKDWVZLPVLQmz-smnPXWDQWVUHVXOWHGLQOHVVGLVWDQFHPRYHGFRPSDUHG
WRZLOGW\SHVDQGWKDWWKLVGHILFLWZDVUHVFXHGE\H[SUHVVLQJ+X'LQWKHLUPRWRQHXURQV)LJ'
SRQHZD\$129$,QDGGLWLRQERWKWKHPHDQERG\FXUYDWXUHFKDQJHSHUVZLPKDOIF\FOHDQG
WKHPHDQQXPEHURIVZLPKDOIF\FOHVSHUVZLPZHUHDOVRGHFUHDVHGLQmz-smnPXWDQWVFRPSDUHGWRZLOG
W\SHVDQGWKHVHZHUHUHVFXHGE\H[SUHVVLQJ+X'LQmz-smn-/-PRWRQHXURQV)LJ()SRQH
ϭϴ
ZD\$129$:LOGW\SHDQGmz-smn; MN-HuDILVKZHUHQRWVWDWLVWLFDOO\GLIIHUHQWS!IRUDQ\RIWKHVH
WHVWVVXJJHVWLQJWKDWWKHVHPRYHPHQWVZHUHIXOO\UHVFXHG7KHVHVZLPSDUDPHWHUVZHUHDOVRGHFUHDVHGLQ
+X'PXWDQWVFRPSDUHGWRZLOGW\SHODUYDHDQGUHVFXHGE\GULYLQJ+X'LQPRWRQHXURQVGDWDQRWVKRZQ
7DNHQWRJHWKHUWKHVHUHVXOWVVXSSRUWWKDW+X'FDQUHVFXHWKHIXQFWLRQDOGHIHFWVLQPRWRQHXURQVFDXVHGE\
ORZOHYHOVRI601
Gap4351$LVGHFUHDVHGLQmz-smnDQGHuDPXWDQWV
+X'ELQGVWRP51$VDIIHFWLQJWKHLUVWDELOLW\DQGWUDQVSRUW,I601DQG+X'DUHDIIHFWLQJP51$WKHQZH
ZRXOGH[SHFWWRVHHDQDOWHUDWLRQLQD+X'WDUJHWP51$*DSLVDQHXUDOVSHFLILFSKRVSKRSURWHLQ
HQULFKHGLQJURZWKFRQHVDQGLQYROYHGLQQHXUDOGHYHORSPHQWUHJHQHUDWLRQDQGSODVWLFLW\0HLULHWDO
%HQRZLW]DQG5RXWWHQEHUJ/RFDOL]HGWUDQVODWLRQRIGap43P51$LQD[RQVLVLPSRUWDQWIRUD[RQDO
JURZWK'RQQHOO\HWDO+X'ELQGVDGHILQHGXULGLQHULFKUHJLRQRIWKHGap43¶875&KXQJHWDO
<RRHWDODQGGHFUHDVLQJ+X'OHDGVWRGHFUHDVHGOHYHOVRIGap43LQ3&FHOOVDQGOHVV
VWDEOHGap43P51$VXJJHVWLQJWKH+X'ELQGLQJWRGap43VWDELOL]HVWKLVPHVVDJH0REDUDNHWDO
0RUHRYHUGHFUHDVHGOHYHOVRI601LQFXOWXUHGQHXURQVDOVROHDGVWRGHFUHDVHGD[RQDOGap43)DOOLQLHW
DO:HWKHUHIRUHDVNHGZKHWKHUGap43P51$OHYHOVZHUHDOWHUHGLQmz-smnDQGHuDPXWDQWV:H
LVRODWHGWUXQNVVSLQDOFRUGDQGPXVFOHIURPGSIHPEU\RVDQGXVHGGLJLWDOGURSOHW3&5GG3&5WR
TXDQWLWDWHWKHOHYHOVRIGap43 P51$FRPSDUHGWRDFRQWUROP51$ubiquitin-conjugating enzyme E2A
Ube2a:HIRXQGWKDWLQERWKPXWDQWVGap43ZDVVLJQLILFDQWO\GHFUHDVHGFRPSDUHGWRFRQWURODQLPDOV
)LJSZWYHUVXVmz-smnDQGZWYHUVXVHuD$129$+ROP6LGDNSRVWKRFDQDO\VLV7R
GHWHUPLQHZKHWKHUWKLVGHFUHDVHLQGap43P51$ZDVGXHWR51$OHYHOVLQPRWRQHXURQVZHPHDVXUHG
Gap43P51$LQmz-smnDQGHuDPXWDQWVZLWK+X'WUDQVJHQLFDOO\DGGHGEDFNWRPRWRQHXURQVXVLQJWKH
*DO8$6V\VWHP,QWKHVHDQLPDOVGap43OHYHOVZHUHQRWVLJQLILFDQWO\GLIIHUHQWWKDQOHYHOVLQZLOGW\SH
DQLPDOV)LJS ZWYHUVXVmz-smn-/-; HuD MNS ZWYHUVXVHuD-/-; HuD MN7KHVHGDWD
VXSSRUWWKDW+X'HIIHFWVGap4351$OHYHOVLQPRWRQHXURQVDQGWKDW601LVFULWLFDOIRUWKLVSURFHVV
ϭϵ
'LVFXVVLRQ
,WUHPDLQVXQUHVROYHGKRZORZOHYHOVRI601GLUHFWO\OHDGWRPRWRQHXURQGHIHFWVDKDOOPDUNRIWKH
FKLOGKRRGPRWRQHXURQGLVHDVH60$,WLVFOHDUWKDW601KHOSVIDFLOLWDWHWKHIRUPDWLRQRI51$SURWHLQ
FRPSOH[HV7KLVKDVEHHQVKRZQE\H[WHQVLYHELRFKHPLVWU\IRUVQ513DVVHPEO\3HOOL]]RQLHWDO
3HOOL]]RQLDQGPRUHUHFHQWO\IRUP513DVVHPEO\'RQOLQ$VSHWDO'XHWRWKHILQGLQJWKDW
ORZOHYHOVRI601FDXVHGHILFLHQFLHVLQPRWRQHXURQGHYHORSPHQWWKDW601LVSUHVHQWLQPRWRUD[RQV
GXULQJGHYHORSPHQWDQGLQYLWURKDVEHHQVKRZQWRELQGQHXURQDO5%3VZHK\SRWKHVL]HGWKDW6015%3
FRPSOH[HVKDGDUROHLQPRWRQHXURQGHYHORSPHQW8VLQJDJHQHWLFPRGHOZLWKORZOHYHOVRI601DQG
DQDO\]LQJWKHVHLQWHUDFWLRQVGLUHFWO\LQPRWRQHXURQVZHGHPRQVWUDWHDSK\VLFDOSURWHLQSURWHLQLQWHUDFWLRQ
EHWZHHQ601DQG+X'LQPRWRQHXURQVGXULQJGHYHORSPHQW0RUHRYHUZHVKRZWKDW601OHYHOVGLFWDWH
+X'SURWHLQOHYHOV*HQHUDWLQJ+X'PXWDQWVUHYHDOHGWKDWWKH\WRRKDGVLPLODUPRWRQHXURQGHYHORSPHQWDO
GHIHFWVVXSSRUWLQJWKDWWKHVHSURWHLQVDIIHFWWKHVDPHSURFHVV([SUHVVLQJ+X'LQmz-smnPXWDQW
PRWRQHXURQVUHVFXHGERWKWKHGHYHORSPHQWDOGHIHFWVDWWKHFHOOXODUOHYHOEXWDOVRWKHPRWRUGHILFLWV
SUHVHQWLQWKHVHPXWDQWV,PSRUWDQWO\ZKHQ601OHYHOVZHUHORZRUZKHQ+X'ZDVODFNLQJGap43P51$
ZKRVHORFDOWUDQVODWLRQDIIHFWVD[RQDOJURZWKZDVGHFUHDVHG7RJHWKHUWKHVHGDWDVXSSRUWDUROHIRU
601+X'LQPRWRQHXURQGHYHORSPHQWDQGIXQFWLRQ0HFKDQLVWLFDOO\WKH\LPSOLFDWHP51$GLVUXSWLRQDVWKH
FDXVHRIWKHVHGHIHFWV
5%3VELQGP51$VRIWHQNHHSLQJWKHPWUDQVODWLRQDOO\VLOHQW,QWKLVZD\P51$VFDQEHWUDQVSRUWHG
DQGWKHQORFDOO\V\QWKHVL]HG:KHQ5%3VDUHPLVVLQJP51$VDUHDWWKHULVNRIEHLQJGHJUDGHG2XULQYLYR
GDWDVXSSRUWWKLVK\SRWKHVLVDVGap43P51$ZDVGHFUHDVHGZKHQ+X'ZDVPLVVLQJRUZKHQ601OHYHOV
ZHUHORZ7KLVLVFRQVLVWHQWWRZKDWZDVREVHUYHGLQFXOWXUHG3&FHOOVZKHUHGap43P51$ZDVOHVV
VWDEOHZKHQ+X'ZDVGHFUHDVHG0REDUDNHWDO6LQFH+X'OHYHOVZHUHDOVRGHFUHDVHGLQmz-smn
PXWDQWVORZGap43OHYHOVFRXOGEHGXHWRORZRUDEVHQW+X'SURWHLQLQERWKPXWDQWV,WLVDOVRSRVVLEOH
WKDW601KHOSVIDFLOLWDWH+X'ELQGLQJWRGap43DQGZKHQ601OHYHOVDUHORZDVLQmz-smnPXWDQWVWKLV
GRHVQRWRFFXU,QYLWURGDWDUHYHDOHGWKDW601IDFLOLWDWHGWKHELQGLQJRIWKH5%3,03WRE-actin51$WKXV
ϮϬ
VXSSRUWLQJWKLVPHFKDQLVP'RQOLQ$VSHWDO7KHUHIRUHERWKPHFKDQLVPVPD\EHDWSOD\LQYLYR
5%3VELQGP51$VDQGWUDQVSRUWWKHPWRD[RQVDQGGHQGULWHVWREHORFDOO\WUDQVODWHGDQGWKLVLVHVVHQWLDO
IRUQHXURQDOGHYHORSPHQWLQFOXGLQJD[RQDOEUDQFKIRUPDWLRQ+ROWDQG6FKXPDQ+RUQEHUJDQG+ROW
:RQJHWDO+X'ELQGVGAP43DQGE-actinWKDWDUHLQYROYHGLQD[RQJURZWKDQGEUDQFK
IRUPDWLRQDQGLQWHUHVWLQJO\QHHGWREHWUDQVODWHGLQWKHD[RQIRUWKHVHIXQFWLRQV'RQQHOO\HWDO
:RQJHWDO'DWDIURPFXOWXUHG3&FHOOVDOVRVKRZHGWKDWERWK+X'DQGGap43ZHUHQHHGHGIRU
QHXULWHRXWJURZWK0REDUDNHWDO,03DQ5%3H[SUHVVHGLQFRPPLVVXUDOD[RQVELQGV51$V
KLJKO\HQULFKHGIRUIXQFWLRQVUHODWHGWRD[RQGHYHORSPHQW3UHLWQHUHWDO:KHQ,03ZDVGHSOHWHG
LQFKLFNHPEU\RVFRPPLVVXUDOD[RQJXLGDQFHZDVGLVUXSWHGVXSSRUWLQJDIXQFWLRQIRU,03OLNH+X'LQ
D[RQGHYHORSPHQW7KLVSURFHVVLVDOVRG\QDPLFDVP51$VLQD[RQVDQGJURZWKFRQHVFKDQJHGUDPDWLFDOO\
RYHUGHYHORSPHQWVXSSRUWLQJWKDWWKHUHTXLUHPHQWIRUSDUWLFXODUP51$VLQGLVWDOD[RQVFKDQJHVRYHUWLPH
=LYUDMHWDO6KLJHRNDHWDO7KXVZHK\SRWKHVL]HWKDWGHFUHDVHG+X'ZRXOGUHVXOWLQOHVV
P51$WUDQVSRUWLQWRD[RQVZKLFKZRXOGKDYHDQHJDWLYHHIIHFWRQD[RQDORXWJURZWKDQGEUDQFKIRUPDWLRQ
GXULQJGHYHORSPHQW,WZLOOEHFULWLFDOWRLGHQWLI\ZKDWP51$VDUHERXQGE\WKH601+X'FRPSOH[LQ
PRWRQHXURQVDQGKRZWKHVHP51$VDUHORFDOL]HGGLIIHUHQWO\GXULQJGHYHORSPHQW
+X'NQRFNRXWPLFHOLNHWKH]HEUDILVK+X'PXWDQWVDUHDOVRYLDEOHDQGVXUYLYHLQWRDGXOWKRRG
$NDPDWVXHWDO$ERXWRI\RXQJDGXOWHuDPLFHKDYHDKLQGOLPEFODVSLQJGHIHFWLQGLFDWLQJ
WKHSUHVHQFHRIPRWRUVHQVRU\GHILFLWVDQGKDYHVLJQLILFDQWURWDURGLPSDLUPHQWVXSSRUWLQJDPRWRUGHIHFW
7KHVHPLFHDOVRH[KLELWGHFUHDVHGGHQGULWLFEUDQFKLQJLQFRUWLFDOQHXURQVDQG&$KLSSRFDPSDOQHXURQV
'H%RHUHWDOZKLFKLVFRQVLVWHQWZLWKWKHGHQGULWLFGHIHFWVZHVHHLQ+X'PXWDQW]HEUDILVK
PRWRQHXURQV$GHWDLOHGDQDO\VLVRIPRWRUQHUYHVKDVQRWEHHQSXEOLVKHGKRZHYHUWKHVHPLFHZHUHOHVV
DFWLYHVSHFLILFDOO\LQZDONLQJDQGUXQQLQJDQGKDGLQFUHDVHGVWHUHRW\SHGEHKDYLRUV7KLVFRXOGEHGXHWR
GHIHFWVLQERWKWKHFRUWLFDODQGPRWRUV\VWHPV7KHPRWRUEHKDYLRUGHILFLWVREVHUYHGLQWKH]HEUDILVKHuD
PXWDQWVDQGmz-smnPXWDQWVZHUHLQLQLWLDWLQJVZLPVDQGWXUQVDQGVXVWDLQLQJWKHVHPRYHPHQWVZKLFK
WRJHWKHU\LHOGHGUHGXFHGPRYHPHQW2XUREVHUYDWLRQRIUHGXFHGERG\FXUYDWXUHVZLPKDOIF\FOHVLQERWK
mz-smnDQGHuDPXWDQWVUHIOHFWVWKDWWKHPXVFOHLVOHVVLQQHUYDWHGRUDFWLYDWHG1HXURPXVFXODUMXQFWLRQV
Ϯϭ
IRUPRQD[RQDOEUDQFKHVWKXVWKLVGHFUHDVHGPRYHPHQWLVFRQVLVWHQWZLWKWKHGHFUHDVHGD[RQDOEUDQFKLQJ
REVHUYHGLQWKHVHPXWDQWV7KLVLVDOVRVXSSRUWHGE\WKHILQGLQJWKDWSDUWLDOPRWRUQHUYHDEODWLRQFDXVHVD
VLPLODUEHKDYLRUDOGHIHFWWRZKDWLVVHHQLQERWKmz-smnDQGHuDPXWDQWV5RVHQEHUJHWDO6LQFH
WKHPRWRQHXURQGHQGULWHVDUHDOVRUHGXFHGPRWRQHXURQVPD\UHFHLYHOHVVLQQHUYDWLRQFRQWULEXWLQJWRWKH
GHFUHDVHGDFWLYLW\6LQFHVZLPPLQJLQYROYHVDOWHUQDWLQJVLGHPXVFOHFRQWUDFWLRQVFDXVHGE\DOWHUQDWLQJ
DFWLYDWLRQRIPRWRQHXURQVOHVVDFWLYHPRWRQHXURQVZRXOGEHH[SHFWHGWROHDGWRDUHGXFWLRQLQDOWHUQDWLQJ
PXVFOHFRQWUDFWLRQVDQGWKXVOHVVGLVWDQFHPRYHG,QGHHGERWKPXWDQWVZHUHVLJQLILFDQWO\ZRUVHWKDQZLOG
W\SHVDWWKHVHEHKDYLRUV,PSRUWDQWO\WKHVHGHIHFWVZHUHREVHUYHGLQERWKmz-smnDQGHuDPXWDQWVDQG
ZHUHUHVFXHGE\GULYLQJ+X'LQPRWRQHXURQVLQGLFDWLQJDFHOODXWRQRPRXVQHHGIRU+X'LQPRWRQHXURQ
GHYHORSPHQWDQGIXQFWLRQ
+RZFRXOGLQFUHDVLQJ+X'LQ601GHILFLHQWPRWRQHXURQVOHDGWRPRWRQHXURQUHVFXH":HVKRZHG
WKDW601LVUHTXLUHGIRUQRUPDO+X'OHYHOVWKXVZKHQ601LVGHSOHWHGVRLV+X',WLVLQWULJXLQJWKDWRQO\
ZKHQ601ZDVLQFUHDVHGE\KHDWVKRFNDWEXWQRWKSIGLGLWLQFUHDVH+X'SURWHLQOHYHOV7KLVUHVXOW
VXJJHVWVWKDW601¶VDIIHFWRQ+X'LVWHPSRUDOO\UHJXODWHGKDYLQJLWVDIIHFWEHIRUHEXWQRWDIWHUPRWRUD[RQ
RXWJURZWKKDVEHHQLQLWLDWHG601LVSUHVHQWLQSRO\VRPHIUDFWLRQVDQGDIIHFWVSURWHLQOHYHOVDFWLQJWRHLWKHU
DFWLYDWHRUUHSUHVVWKHLUH[SUHVVLRQ6DQFKH]HWDO,QWKLVFDVHZHGRQRWNQRZDWZKDWOHYHO601
LVDIIHFWLQJ+X'EXWSUHYLRXVZRUNVKRZHGWKDW601UHJXODWHG3ODVWLQOHYHOVYLDDSRVWWUDQVFULSWLRQDO
PHFKDQLVP+DROHHWDO(YHQWKRXJKZHVKRZWKDW601DQG+X'LQWHUDFWLWLVSRVVLEOHWKDWKLJKHU
OHYHOVRI+X'FDQFRPSHQVDWHIRUORZOHYHOVRI601)RUH[DPSOHRYHUH[SUHVVLQJ+X'LQHPEU\RQLFUDW
FRUWLFDOQHXURQVLQFUHDVHGQHXULWHIRUPDWLRQDQGGAP43H[SUHVVLRQ$QGHUVRQHWDO2XUGDWDDOVR
VXSSRUWVDFHOODXWRQRPRXVUROHIRU+X'LQPRWRQHXURQGHYHORSPHQW+RZHYHUGULYLQJ+X'LQ
PRWRQHXURQVWUDQVJHQLFDOO\GLGQRWOHDGWRDFRPSOHWHUHVFXHRImz-smnPRWRQHXURQVDWWKHFHOOXODUOHYHO
7KXVWKHUHLVWKHSRVVLELOLW\WKDW+X'FRXOGKDYHDQRQFHOODXWRQRPRXVIXQFWLRQWKDWDIIHFWVPRWRQHXURQV
%HFDXVH+X'LVDQHXURQDO5%3LWZRXOGKDYHWREHDFWLQJWKURXJKRWKHUQHXURQV7KLVODFNRIFRPSOHWH
UHVFXHFRXOGDOVRLQGLFDWHWKDWRWKHU5%3VDUHIXQFWLRQLQJLQPRWRQHXURQVDQGDUHDIIHFWHGE\6017KLVLV
ϮϮ
VXSSRUWHGE\GDWDVKRZLQJWKH601LQWHUDFWVZLWKWKH5%3,03LQPRWRQHXURQVDQGWKLVLQWHUDFWLRQ
DIIHFWVGAP43OHYHOVLQFXOWXUHGPRWRQHXURQDOD[RQV)DOOLQLHWDO
601LVLQYROYHGLQIDFLOLWDWLQJWKHIRUPDWLRQRISURWHLQ51$FRPSOH[HVIRUVSOLFLQJ'HILFLHQF\LQWKLV
IXQFWLRQFRUUHODWHVZLWKSKHQRW\SHVLQ60$DOWKRXJKKRZWKLVIXQFWLRQGLUHFWO\DIIHFWVPRWRQHXURQVKDVQRW
EHHQUHVROYHG,QWHUHVWLQJO\WKHVSOLFLQJIDFWRU6)34ZDVUHFHQWO\VKRZQWRKDYHDQRQQXFOHDUIXQFWLRQ
WKDWFRQWUROVWUDQVFULSWVLPSRUWDQWIRUPRWRQHXURQGHYHORSPHQW7KRPDV-LQXHWDO/LNH601
6)34LVDOVRIRXQGLQPRWRUD[RQVDQGDIIHFWVVSOLFLQJRIQXPHURXVWUDQVFULSWVWKDWFRXOGIXQFWLRQLQ
PRWRQHXURQGHYHORSPHQWVXFKDVFHOODGKHVLRQFHOOSRODULW\GHQGULWLFVSLQHIRUPDWLRQDQGV\QDSVH
IRUPDWLRQ&RPSDUHGWRWKHmz-smnPXWDQWVKRZHYHUSFPQPXWDQWVH[KLELWHGPXFKPRUHVHYHUH
PRWRQHXURQGHYHORSPHQWDOGHIHFWV0RWRUD[RQVIDLOHGWRH[WHQGWRWKHGLVWDOPXVFOHRIWHQEDUHO\OHDYLQJ
WKHVSLQDOFRUGDQGQHXURPXVFXODUMXQFWLRQV10-VZHUHODUJHO\DEVHQW7KLVVXJJHVWVWKDWGHIHFWVLQ
VSOLFLQJFDQKDYHDSURIRXQGDIIHFWRQPRWRQHXURQGHYHORSPHQW,I601GHILFLHQF\ZHUHSULPDULO\FDXVLQJ
VSOLFLQJGHIHFWVWKHQZHZRXOGH[SHFWPDQ\IHZHU51$VWREHDOWHUHGVLQFHmz-smnPXWDQWVKDYHDPLOGHU
PRWRQHXURQSKHQRW\SHWKDQWKH6)34PXWDQWV7ZRJHQHVKDYHEHHQLGHQWLILHGWKDWH[KLELWVSOLFLQJ
GHIHFWVFDXVHGE\ORZOHYHOVRI601DQGDIIHFWPRWRQHXURQV7KHVHJHQHVstasimonDQGchondrolectin
ZKHQLQWURGXFHGWUDQVLHQWO\LQWR601GHILFLHQW]HEUDILVKFDQSDUWLDOO\UHVFXHPRWRQHXURQGHIHFWV/RWWLHW
DO6OHLJKHWDO,QDGGLWLRQ$JULQ=IRUPDSURWHLQLQYROYHGLQ10-IRUPDWLRQZDVDOVR
VKRZQWREHPLVSOLFHGZKHQ601OHYHOVZHUHORZDQGDGGLQJWKLVEDFNWR60$PLFHUHVFXHGWKH
GHYHORSPHQWDO10-GHIHFW=KDQJHWDO.LPHWDO7KXVORZOHYHOVRI601PD\DIIHFWP51$
OHYHOVDQGWUDQVSRUWDQGDOVRVSOLFLQJRIDVPDOOQXPEHURIJHQHVFULWLFDOIRUPRWRQHXURQGHYHORSPHQW
601LVDQRUJDQL]HURI51$SURWHLQFRPSOH[HVDQGZKHQGHILFLHQWOHDGVWRDPRWRQHXURQGLVHDVH
:HKDYHVKRZQWKDW601LQWHUDFWVZLWK+X'LQPRWRQHXURQVWRDIIHFWPRWRUD[RQDQGGHQGULWH
GHYHORSPHQWDQG51$OHYHOV%DVHGRQWKHVHGDWDZHK\SRWKHVL]HWKDW601LQWHUDFWVZLWK5%3VWRWUDIILF
P51$VWRJURZLQJEUDQFKLQJD[RQVDQGGHQGULWHVIRUORFDOL]HGWUDQVODWLRQDSURFHVVYLWDOIRUWKHLU
IRUPDWLRQ)XWXUHZRUNZLOOLGHQWLI\WKHIXOOFRPSOHPHQWRI6015%3LQWHUDFWLRQVLQGHYHORSLQJPRWRQHXURQV
DQGWKHLUFDUJRP51$V
Ϯϯ
)LJXUHOHJHQGV
)LJXUH601DQG+X'FRLPPXQRSUHFLSLWDWHIURPPRWRQHXURQVEXWRQO\GXULQJWKHSHULRGRIPRWRU
D[RQGHYHORSPHQW$6FKHPDWLFGLDJUDPRIWKHWUDQVJHQLFFRQVWUXFWVGULYLQJZLOGW\SHKXPDQK601
K6014$DQGK601(.LQPRWRQHXURQV%,PPXQRSUHFLSLWDWLRQXVLQJQRDQWLERG\1R$ERUDQWL
5)35)3$EDQGLPPXQREORWWLQJZLWK601DQG+X'$QDO\VLVZDVSHUIRUPHGDWDQGGSI7RWDOUHIHUVWR
WRWDOSURWHLQ
)LJXUH+X'OHYHOVDUHGHSHQGHQWRQ601$:HVWHUQEORWRIZLOGW\SHZWDQGmz-smnPXWDQWVHLWKHU
QRWKHDWVKRFNHGRUKHDWVKRFNHGDWRUKSI%:HVWHUQEORWRIZWHPEU\RVHLWKHUQRWKHDWVKRFNHG
RUKHDWVKRFNHGDWKSI3URWHLQZDVFROOHFWHGKRXUVSRVWKHDWVKRFN+X'5)3601DQG]HEUDILVK
]I601ZHUHDQDO\]HGE\:HVWHUQEORWEDFWLQZDVXVHGDVDORDGLQJFRQWURO
)LJXUH+X'PXWDQWVGLVSOD\PRWRUD[RQGHIHFWVVLPLODUWRmz-smnPXWDQW$)RXU+X'PXWDQWV
ZHUHJHQHUDWHGE\&5,635&DVXVLQJWZRXQLTXHJXLGH51$VIRU+X'WDUJHWDQG+X'WDUJHW7KHVL]HRI
WKHLQVHUWLRQLQRUGHOHWLRQGHODUHQRWHG:HVWHUQEORWDQDO\VLVRISURWHLQIURPZLOGW\SHZWDQGWKHIRXU
+X'KRPR]\JRXVPXWDQWVDWGSIEDFWLQZDVXVHGDVDORDGLQJFRQWURO/DWHUDOYLHZRIKSI%ZLOG
W\SHZWDQG&+X'RVSURFHVVHGIRU]QSV\QDSWRWDJPLQDQWLERG\ODEHOLQJWRYLVXDOL]HPRWRUD[RQV
$UURZVGHQRWHYHQWUDOPRWRUD[RQV'4XDQWLILFDWLRQRIZWDQG+X'DQLPDOVEDVHGRQWKHLUPRWRUD[RQ
GHIHFWVDWaKSIVHHPHWKRGVIRUD[RQVFRULQJUXEULFQ ZWDQGQ PXWDQWVIURPWKUHHVHSDUDWH
FOXWFKHVRIHPEU\RVPHDQ“6(0S0DQQ:KLWQH\QRQSDUDPHWULFUDQNWHVW(,QGLYLGXDO
PRWRQHXURQVZHUHVWRFKDVWLFDOO\ODEHOHGE\LQMHFWLQJPQ[*)3LQWRRQHFHOOVWDJHHPEU\RVDQGLPDJHGE\
FRQIRFDOPLFURVFRS\DWGSI$UURZVGHQRWHD[RQDOEUDQFKHVLQWKHYHQWUDOPXVFOH)4XDQWLILFDWLRQRIPRWRU
D[RQEUDQFKLQJDWGSIXVLQJVLQJOHD[RQODEHOLQJD[RQWUDFLQJDQGPHDVXUHPHQWRIWRWDOD[RQDQGEUDQFK
Ϯϰ
OHQJWKPHDQ“6'SDVGHWHUPLQHGE\DWZRWDLOHG7WHVWRILQGHSHQGHQWVDPSOHVZLWKHTXDO
YDULDQFHVDQGGHJUHHVRIIUHHGRPQ D[RQVIRUZWDQGQ D[RQVIRUPXWDQWV6FDOHEDUPP%&
PP()
)LJXUH0RWRQHXURQGHQGULWHVLQ+X'PXWDQWVDUHGUDPDWLFDOO\GHFUHDVHGLQOHQJWK,QGLYLGXDO*)3
ODEHOHGPRWRQHXURQVLQDZLOGW\SHZWDQG+X'PXWDQWDWGSI&4XDQWLILFDWLRQRIWRWDOGHQGULWHOHQJWK
XVLQJGHQGULWHWUDFLQJVHHPHWKRGVPHDQ“6'SDVGHWHUPLQHGE\DWZRWDLOHG7WHVWRI
LQGHSHQGHQWVDPSOHVZLWKXQHTXDOYDULDQFHVDQGGHJUHHVRIIUHHGRPQ IRUZWDQGQ IRUPXWDQWV
6FDOHEDUPP
)LJXUH0RWRUD[RQGHIHFWVLQ+X'PXWDQWVDUHUHVFXHGE\H[SUHVVLQJ+X'LQPRWRQHXURQV/DWHUDO
YLHZRIODEHOHGPRWRUD[RQVIURPKSI$ZLOGW\SH%HuDDQG&HuDMN-HuD'4XDQWLILFDWLRQRI
DQLPDOVEDVHGRQWKHLUPRWRUD[RQGHIHFWVQUDQJHGIURPIRUHDFKH[SHULPHQWDOOLQHIURPWKUHH
VHSDUDWHFOXWFKHVRIHPEU\RVPHDQ“6(03YDOXHVZHUHGHWHUPLQHGE\0DQQ:KLWQH\QRQSDUDPHWULF
UDQNWHVWWZRWDLOHGZWYHUVXVHuD-SHuDYHUVXVHuDMN-HuD, ***SZWYHUVXV
HuDMN-HuD, S MN-HuDUHIHUVWRTg(mnx1:Gal4);Tg(UAS:mCherry-HuD)6FDOHEDUPP
)LJXUH([SUHVVLQJ+X'H[FOXVLYHO\LQPRWRQHXURQVUHVFXHVWKHPRWRUD[RQEUDQFKLQJDQGGHQGULWH
GHIHFWVLQ+X'PXWDQWV&RQIRFDOLPDJHDQGWUDFLQJRILQGLYLGXDOD[RQVLQGSI$$¶ZLOGW\SHQ %
%¶HuDQ DQG&&¶HuDMN-HuD Q DQLPDOV'4XDQWLILFDWLRQRIPRWRUD[RQVDQGEUDQFK
OHQJWKPHDQ“6'3YDOXHVGHWHUPLQHGE\DWZRWDLOHG7WHVWRILQGHSHQGHQWVDPSOHVZWYHUVXVHuD
SHTXDOYDULDQFHVGHJUHHVRIIUHHGRPHuDYHUVXVHuDMN-HuDSXQHTXDO
YDULDQFHVGHJUHHVRIIUHHGRPZWYHUVXVHuDMN-HuD,S HTXDOYDULDQFHVGHJUHHVRI
IUHHGRP&RQIRFDOLPDJHVRIGHQGULWHVLQGSI (ZLOGW\SHQ )HuDQ DQG*HuDMN-HuD
Q DQLPDOV+4XDQWLILFDWLRQRIWRWDOGHQGULWHOHQJWKPHDQ“6'3YDOXHVGHWHUPLQHGE\DWZRWDLOHG7
Ϯϱ
WHVWRILQGHSHQGHQWVDPSOHVZWYHUVXVHuDSXQHTXDOYDULDQFHVGHJUHHVRIIUHHGRPHuD
YHUVXVHuDMN-HuD,SXQHTXDOYDULDQFHVGHJUHHVRIIUHHGRPZWYHUVXVHuDMN-HuD
S XQHTXDOYDULDQFHVGHJUHHVRIIUHHGRPMN-HuDUHIHUVWRTg(mnx1:Gal4);Tg(UAS:mCherryHuD). 6FDOHEDUPP$&PP(*
)LJXUH([SUHVVLQJ+X'LQ601GHSOHWHGPRWRQHXURQVUHVFXHVWKHPRWRUD[RQSKHQRW\SH
/DWHUDOYLHZRIKSI$ZLOGW\SHZW%mz-smnDQG&mz-smnMN-HuD1SURFHVVHGIRU
]QSV\QDSWRWDJPLQDQWLERG\ODEHOLQJWRYLVXDOL]HPRWRUD[RQV$UURZVGHQRWHYHQWUDOPRWRUD[RQV'
4XDQWLILFDWLRQRIDQLPDOVEDVHGRQWKHLUPRWRUD[RQGHIHFWVDVSUHYLRXVO\HVWDEOLVKHGQ IRUHDFK
H[SHULPHQWDOOLQHIURPWKUHHVHSDUDWHFOXWFKHVRIHPEU\RVPHDQ“6(03YDOXHVZHUHGHWHUPLQHGE\0DQQ
:KLWQH\QRQSDUDPHWULFUDQNWHVWWZRWDLOHGZWYHUVXVmz-smn-/-Smz-smnYHUVXVmz-smn
MN-HuD1SZWYHUVXVmz-smnMN-HuD1S(4XDQWLWDWLRQRIDQLPDOVEDVHGRQWKHLU
PRWRUD[RQGHIHFWVQ IRUHDFKH[SHULPHQWDOOLQHIURPWKUHHVHSDUDWHFOXWFKHVRIHPEU\RVPHDQ“
6(03YDOXHVZHUHGHWHUPLQHGE\0DQQ:KLWQH\QRQSDUDPHWULFUDQNWHVWWZRWDLOHGZWYHUVXVmz-smn-/-
Smz-smnYHUVXVmz-smnMN-HuD2SZWYHUVXVmz-smnMN-HuD2SMNHuD1UHIHUVWRTg(mnx1:Gal4);Tg(UAS:mCherry-HuD) DQGMN-HuD2UHIHUVWRTg(mnx1:mCherry-HuD)6FDOH
EDUPP
)LJXUH([SUHVVLQJ+X'LQ601GHSOHWHGPRWRQHXURQVUHVFXHVWKHD[RQEUDQFKLQJDQGGHQGULWH
GHIHFWV&RQIRFDOLPDJHDQGWUDFLQJRILQGLYLGXDOD[RQVLQGSI$$¶ZLOGW\SHQ %%¶mz-smn-/-
Q DQG&&¶mz-smnMN-HuD Q DQLPDOV'4XDQWLILFDWLRQRIPRWRUD[RQVDQGEUDQFKOHQJWK
PHDQ“6'3YDOXHVGHWHUPLQHGE\DWZRWDLOHG7WHVWRILQGHSHQGHQWVDPSOHVZWYHUVXVmz-smn-/-
SXQHTXDOYDULDQFHVGHJUHHVRIIUHHGRPmz-smnYHUVXVmz-smnMN-HuD,SHTXDO
YDULDQFHVGHJUHHVRIIUHHGRPZWYHUVXVmz-smnMN-HuD,S HTXDOYDULDQFHVGHJUHHVRI
IUHHGRP
Ϯϲ
&RQIRFDOLPDJHVRIGHQGULWHVLQGSI (ZLOGW\SHQ )mz-smnQ DQG*mz-smnMN-HuD
Q DQLPDOV+4XDQWLILFDWLRQRIWRWDOGHQGULWHOHQJWKPHDQ“6'3YDOXHVZHUHGHWHUPLQHGE\DWZR
WDLOHG7WHVWRILQGHSHQGHQWVDPSOHVZWYHUVXVmz-smnSXQHTXDOYDULDQFHVGHJUHHVRI
IUHHGRPmz-smnYHUVXVmz-smnMN-HuD, SXQHTXDOYDULDQFHVGHJUHHVRIIUHHGRPZW
YHUVXVmz-smnMN-HuD,SHTXDOYDULDQFHVGHJUHHVRIIUHHGRPMN-HuDUHIHUVWR
Tg(mnx1:Gal4);Tg(UAS:mCherry-HuD). 6FDOHEDUPP$&PP(*
)LJXUH0RWRUEHKDYLRUDQDO\VLV$*URVVPRYHPHQWRYHUVHFRQGV(DFKGRWUHSUHVHQWVLQGLYLGXDO
ODUYD%&0HDQIUHTXHQF\RIVZLPRUWXUQLQLWLDWLRQLQmz-smn-/-%DQGHuD-/-ODUYDH&1 JURXSVRI
ODUYDHJURXS'0HDQGLVWDQFHSHUVZLP(0HDQERG\FXUYDWXUHFKDQJHSHUKDOIVZLPF\FOH)0HDQ
QXPEHURIKDOIVZLPF\FOHVSHUVZLP)RU')1VZLPVHYDOXDWHGZW mz-smn-/- mz-smn-/-; MNHuD MN-HuD UHIHUVWRTg(mnx1:Gal4);Tg(UAS:mCherry-HuD)$OOJUDSKVDUHPHDQ“6(0DQGS
YDOXHVSSS$129$%RQIHUURQLSRVWKRFDQDO\VLV
)LJXUH'HFUHDVHGGap43P51$OHYHOVLQHuDDQGmz-smnPXWDQWVDUHUHVFXHGE\+X'LQ
PRWRQHXURQVGap43P51$IURPGSIHPEU\RVDQLPDOVJHQRW\SHZDVDQDO\]HGE\GG3&5DQG
H[SUHVVHGDVDUDWLRRIFRQWUROP51$Ube2a PHDQ“6(0MN-HuD UHIHUVWR
Tg(mnx1:Gal4);Tg(UAS:mCherry-HuD)S$129$+ROP6LGDNSRVWKRFDQDO\VLV
Ϯϳ
5HIHUHQFHV
$NDPDWVX:)XMLKDUD+0LWVXKDVKL7<DQR06KLEDWD6+D\DNDZD<2NDQR+-
6DNDNLEDUD67DNDQR+7DNDQR77DNDKDVKL71RGD72NDQR+7KH51$
ELQGLQJSURWHLQ+X'UHJXODWHVQHXURQDOFHOOLGHQWLW\DQGPDWXUDWLRQ3URF1DWO$FDG6FL
86$
$NWHQ%.\H0-+DROH7:HUW]0+6LQJK61LH'+XDQJ-0HULDQGD777ZLVV-/%HDWWLH
&(6WHHQ-$6DKLQ0,QWHUDFWLRQRIVXUYLYDORIPRWRUQHXURQ601DQG+X'
SURWHLQVZLWKP51$FSJUHVFXHVPRWRUQHXURQD[RQDOGHILFLWV3URF1DWO$FDG6FL8
6$
$QGHUVRQ.'6HQJXSWD-0RULQ01HYH5/9DOHQ]XHOD&)3HUURQH%L]]R]HUR1,
2YHUH[SUHVVLRQRI+X'DFFHOHUDWHVQHXULWHRXWJURZWKDQGLQFUHDVHV*$3P51$
H[SUHVVLRQLQFRUWLFDOQHXURQVDQGUHWLQRLFDFLGLQGXFHGHPEU\RQLFVWHPFHOOVLQYLWUR
([S1HXURO
%HQRZLW]/,5RXWWHQEHUJ$$0HPEUDQH3KRVSKRSURWHLQ$VVRFLDWHGZLWK1HXUDO
'HYHORSPHQW$[RQDO5HJHQHUDWLRQ3KRVSKROLSLG0HWDEROLVPDQG6\QDSWLF3ODVWLFLW\
7UHQGV1HXURVFL
%LVZDV6(PRQG05'X\34+DROH7%HDWWLH&(-RQWHV-'3URWRFDGKHULQE
LQWHUDFWVZLWK1DSWRFRQWUROPRWRUD[RQJURZWKDQGDUERUL]DWLRQLQ]HEUDILVK0RO%LRO
&HOO
%RRQ./;LDR60F:KRUWHU0/'RQQ7:ROI6D[RQ(%RKQVDFN070RHQV&%%HDWWLH&(
=HEUDILVKVXUYLYDOPRWRUQHXURQPXWDQWVH[KLELWSUHV\QDSWLFQHXURPXVFXODU
MXQFWLRQGHIHFWV+XP0RO*HQHW
%RZHUPDQ0$QGHUVRQ&/%HDXYDLV$%R\O33:LWNH:.RWKDU\5601SURILOLQ,,D
DQGSODVWLQDOLQNEHWZHHQWKHGHUHJXODWLRQRIDFWLQG\QDPLFVDQG60$SDWKRJHQHVLV
0RO&HOO1HXURVFL
%XUJHVV+$*UDQDWR0D6HQVRULPRWRUJDWLQJLQODUYDO]HEUDILVK-1HXURVFL
%XUJHVV+$*UDQDWR0E0RGXODWLRQRIORFRPRWRUDFWLYLW\LQODUYDO]HEUDILVKGXULQJOLJKW
DGDSWDWLRQ-([S%LRO
&DUUHO7/0F:KRUWHU0/:RUNPDQ(=KDQJ+:ROVWHQFURIW(&/RUVRQ&%DVVHOO*-
%XUJKHV$+%HDWWLH&(6XUYLYDOPRWRUQHXURQIXQFWLRQLQPRWRUD[RQVLV
LQGHSHQGHQWRIIXQFWLRQVUHTXLUHGIRUVPDOOQXFOHDUULERQXFOHRSURWHLQELRJHQHVLV-
1HXURVFL
&KXQJ6(FNULFK03HUURQH%L]]R]HUR1.RKQ'7)XUQHDX[+7KH(ODYOLNHSURWHLQV
ELQGWRDFRQVHUYHGUHJXODWRU\HOHPHQWLQWKH
XQWUDQVODWHGUHJLRQRI*$3P51$-
%LRO&KHP
'DKOHP7-+RVKLMLPD.-XU\QHF0-*XQWKHU'6WDUNHU&*/RFNH$6:HLV$09R\WDV')
*UXQZDOG'-6LPSOHPHWKRGVIRUJHQHUDWLQJDQGGHWHFWLQJORFXVVSHFLILF
PXWDWLRQVLQGXFHGZLWK7$/(1VLQWKH]HEUDILVKJHQRPH3/R6*HQHWH
'DOJLQ*:DUG$%+DROH7%HDWWLH&(1HFKLSRUXN$3ULQFH9(=HEUDILVKPQ[
FRQWUROVFHOOIDWHFKRLFHLQWKHGHYHORSLQJHQGRFULQHSDQFUHDV'HYHORSPHQW
'H%RHU(0$]HYHGR59HJD7$%URGNLQ-$NDPDWVX:2NDQR+:DJQHU*&5DVLQ05
3UHQDWDOGHOHWLRQRIWKH51$ELQGLQJSURWHLQ+X'GLVUXSWVSRVWQDWDOFRUWLFDO
FLUFXLWPDWXUDWLRQDQGEHKDYLRU-1HXURVFL
'RQOLQ$VS3*)DOOLQL&&DPSRV-&KRX&&0HUULWW0(3KDQ+&%DVVHOO*-5RVVROO:
7KH6XUYLYDORI0RWRU1HXURQ3URWHLQ$FWVDVD0ROHFXODU&KDSHURQHIRUP513
$VVHPEO\&HOO5HS
Ϯϴ
'RQQHOO\&-3DUN06SLOODQH0<RR63DFKHFR$*RPHV&9XSSDODQFKL'0F'RQDOG0
.LP++0HULDQGD77*DOOR*7ZLVV-/$[RQDOO\V\QWKHVL]HGEHWDDFWLQDQG
*$3SURWHLQVVXSSRUWGLVWLQFWPRGHVRID[RQDOJURZWK-1HXURVFL
)DOOLQL&%DVVHOO*-5RVVROO:6SLQDOPXVFXODUDWURSK\WKHUROHRI601LQD[RQDO
P51$UHJXODWLRQ%UDLQ5HV
)DOOLQL&'RQOLQ$VS3*5RXDQHW-3%DVVHOO*-5RVVROO:'HILFLHQF\RIWKH6XUYLYDO
RI0RWRU1HXURQ3URWHLQ,PSDLUVP51$/RFDOL]DWLRQDQG/RFDO7UDQVODWLRQLQWKH*URZWK
&RQHRI0RWRU1HXURQV-1HXURVFL
)DOOLQL&=KDQJ+6X<6LODQL96LQJHU5+5RVVROO:%DVVHOO*-7KHVXUYLYDORI
PRWRUQHXURQ601SURWHLQLQWHUDFWVZLWKWKHP51$ELQGLQJSURWHLQ+X'DQGUHJXODWHV
ORFDOL]DWLRQRISRO\$P51$LQSULPDU\PRWRUQHXURQD[RQV-1HXURVFL
)HQJ:*XELW]$.:DQ/%DWWOH'-'RVWLH-*ROHPEH7-'UH\IXVV**HPLQV
PRGXODWHWKHH[SUHVVLRQDQGDFWLYLW\RIWKH601FRPSOH[+XP0RO*HQHW
+DROH7%XUJKHV$+%HDWWLH&(*HQHUDWLRQDQG&KDUDFWHUL]DWLRQRIDJHQHWLF
]HEUDILVKPRGHORI60$FDUU\LQJWKHKXPDQ601JHQH0RO1HXURGHJHQHU
+DROH7:ROPDQ0*UDQDWR0%HDWWLH&(6XUYLYDOPRWRUQHXURQDIIHFWVSODVWLQ
SURWHLQOHYHOVOHDGLQJWRPRWRUGHIHFWV-1HXURVFL
+DROH7'X\34-RQWHV-'%HDWWLH&(0RWRQHXURQGHYHORSPHQWLQIOXHQFHVGRUVDO
URRWJDQJOLDVXUYLYDODQG6FKZDQQFHOOGHYHORSPHQWLQDYHUWHEUDWHPRGHORIVSLQDO
PXVFXODUDWURSK\+XPDQPROHFXODUJHQHWLFV
+DROH7'X\34-RQWHV-':ROPDQ0*UDQDWR0%HDWWLH&(7HPSRUDOUHTXLUHPHQW
IRU601LQPRWRQHXURQGHYHORSPHQW+XPDQPROHFXODUJHQHWLFV
+ROW&(6FKXPDQ(07KHFHQWUDOGRJPDGHFHQWUDOL]HGQHZSHUVSHFWLYHVRQ51$
IXQFWLRQDQGORFDOWUDQVODWLRQLQQHXURQV1HXURQ
+RUQEHUJ++ROW&51$ELQGLQJSURWHLQVDQGWUDQVODWLRQDOUHJXODWLRQLQD[RQVDQG
JURZWKFRQHV)URQW1HXURVFL
+XEHUV/9DOGHUUDPD&DUYDMDO+/DIUDPERLVH-7LPEHUV-6DQFKH]*&RWH-+X'
LQWHUDFWVZLWKVXUYLYDOPRWRUQHXURQSURWHLQDQGFDQUHVFXHVSLQDOPXVFXODUDWURSK\OLNH
QHXURQDOGHIHFWV+XPDQPROHFXODUJHQHWLFV
,\HU&&0F*RYHUQ9/:LVH'2*ODVV'-%XUJKHV$+'HOHWLRQRIDWURSK\HQKDQFLQJ
JHQHVIDLOVWRDPHOLRUDWHWKHSKHQRW\SHLQDPRXVHPRGHORIVSLQDOPXVFXODUDWURSK\
1HXURPXVFXO'LVRUG
-DR/(:HQWH65&KHQ:(IILFLHQWPXOWLSOH[ELDOOHOLF]HEUDILVKJHQRPHHGLWLQJXVLQJD
&5,635QXFOHDVHV\VWHP3URF1DWO$FDG6FL86$
.DUL\D63DUN*+0DHQR+LNLFKL</H\NHNKPDQ2/XW]&$UNRYLW]06/DQGPHVVHU/7
0RQDQL855HGXFHG601SURWHLQLPSDLUVPDWXUDWLRQRIWKHQHXURPXVFXODU
MXQFWLRQVLQPRXVHPRGHOVRIVSLQDOPXVFXODUDWURSK\+XPDQPROHFXODUJHQHWLFV
.LP-.&DLQH&$ZDQR7+HUEVW50RQDQL850RWRUQHXURQDOUHSOHWLRQRIWKH10-
RUJDQL]HU$JULQPRGXODWHVWKHVHYHULW\RIWKHVSLQDOPXVFXODUDWURSK\GLVHDVH
SKHQRW\SHLQPRGHOPLFH+XP0RO*HQHW
.RQJ/:DQJ;&KRH':3ROOH\0%XUQHWW%*%RVFK0DUFH0*ULIILQ-:5LFK00
6XPQHU&-,PSDLUHGV\QDSWLFYHVLFOHUHOHDVHDQGLPPDWXULW\RIQHXURPXVFXODU
MXQFWLRQVLQVSLQDOPXVFXODUDWURSK\PLFH-1HXURVFL
/LQJ..*LEEV50)HQJ=.R&36HYHUHQHXURPXVFXODUGHQHUYDWLRQRIFOLQLFDOO\
UHOHYDQWPXVFOHVLQDPRXVHPRGHORIVSLQDOPXVFXODUDWURSK\+XP0RO*HQHW
/RWWL),PODFK:/6DLHYD/%HFN(6+DROH7/L'.-LDR:0HQWLV*=%HDWWLH&(
0F&DEH%'3HOOL]]RQL/$Q601GHSHQGHQW8VSOLFLQJHYHQWHVVHQWLDOIRU
PRWRUFLUFXLWIXQFWLRQ&HOO
Ϯϵ
0DUXVLFK0))XUQHDX[+0+HQLRQ3':HVWRQ-$+XQHXURQDOSURWHLQVDUHH[SUHVVHG
LQSUROLIHUDWLQJQHXURJHQLFFHOOV-1HXURELRO
0HLUL.)3IHQQLQJHU.+:LOODUG0%*URZWKDVVRFLDWHGSURWHLQ*$3DSRO\SHSWLGH
WKDWLVLQGXFHGZKHQQHXURQVH[WHQGD[RQVLVDFRPSRQHQWRIJURZWKFRQHVDQG
FRUUHVSRQGVWRSSDPDMRUSRO\SHSWLGHRIDVXEFHOOXODUIUDFWLRQHQULFKHGLQJURZWK
FRQHV3URF1DWO$FDG6FL86$
0REDUDN&'$QGHUVRQ.'0RULQ0%HFNHO0LWFKHQHU$5RJHUV6/)XUQHDX[+.LQJ3
3HUURQH%L]]R]HUR1,7KH51$ELQGLQJSURWHLQ+X'LVUHTXLUHGIRU*$3
P51$VWDELOLW\*$3JHQHH[SUHVVLRQDQG3.&GHSHQGHQWQHXULWHRXWJURZWKLQ
3&FHOOV0RO%LRO&HOO
3HOOL]]RQL/&KDSHURQLQJULERQXFOHRSURWHLQELRJHQHVLVLQKHDOWKDQGGLVHDVH(0%2
5HS
3HOOL]]RQL/<RQJ-'UH\IXVV*(VVHQWLDOUROHIRUWKH601FRPSOH[LQWKHVSHFLILFLW\RI
VQ513DVVHPEO\6FLHQFH
3UHLWQHU14XDQ-/L;1LHOVHQ)&)ODQDJDQ-*,03D[RQDOORFDOL]DWLRQ51$
LQWHUDFWRPHDQGIXQFWLRQLQWKHGHYHORSPHQWRID[RQWUDMHFWRULHV'HYHORSPHQW
5RVHQEHUJ$):ROPDQ0$)UDQ]LQL$UPVWURQJ&*UDQDWR0,QYLYRQHUYH
PDFURSKDJHLQWHUDFWLRQVIROORZLQJSHULSKHUDOQHUYHLQMXU\-1HXURVFL
6DQFKH]*'XU\$<0XUUD\/0%LRQGL27DGHVVH+(O)DWLP\5.RWKDU\5&KDUERQQLHU)
.KDQGMLDQ(:&RWH-$QRYHOIXQFWLRQIRUWKHVXUYLYDOPRWRQHXURQSURWHLQDVD
WUDQVODWLRQDOUHJXODWRU+XP0RO*HQHW
6KLJHRND7-XQJ+-XQJ-7XUQHU%ULGJHU%2KN-/LQ-4$PLHX[36+ROW&(
'\QDPLF$[RQDO7UDQVODWLRQLQ'HYHORSLQJDQG0DWXUH9LVXDO&LUFXLWV&HOO
6OHLJK-1%DUUHLUR,JOHVLDV$2OLYHU3/%LED$%HFNHU7'DYLHV.(%HFNHU&*7DOERW.
&KRQGUROHFWLQDIIHFWVFHOOVXUYLYDODQGQHXURQDORXWJURZWKLQLQYLWURDQGLQYLYR
PRGHOVRIVSLQDOPXVFXODUDWURSK\+XP0RO*HQHW
7DOERW-&$PDFKHU6/$VWUHDPOLQHG&5,635SLSHOLQHWRUHOLDEO\JHQHUDWH]HEUDILVK
IUDPHVKLIWLQJDOOHOHV=HEUDILVK
7KRPDV-LQX6HWDO1RQQXFOHDU3RRORI6SOLFLQJ)DFWRU6)345HJXODWHV$[RQDO
7UDQVFULSWV5HTXLUHGIRU1RUPDO0RWRU'HYHORSPHQW1HXURQH
:HVWHUILHOG07KH=HEUDILVK%RRN8QLYHUVLW\RI2UHJRQ3UHVV(XJHQH25
:ROPDQ0$-DLQ5$/LVV/*UDQDWR0&KHPLFDOPRGXODWLRQRIPHPRU\IRUPDWLRQLQ
ODUYDO]HEUDILVK3URF1DWO$FDG6FL86$
:RQJ++/LQ-46WURKO)5RTXH&*&LRQL-0&DJQHWWD57XUQHU%ULGJHU%/DLQH5)
+DUULV:$.DPLQVNL&)+ROW&(51$'RFNLQJDQG/RFDO7UDQVODWLRQ5HJXODWH
6LWH6SHFLILF$[RQ5HPRGHOLQJ,Q9LYR1HXURQH
;X+/L&=HQJ4$JUDZDO,=KX;*RQJ=*HQRPHZLGHLGHQWLILFDWLRQRIVXLWDEOH
]HEUDILVK'DQLRUHULRUHIHUHQFHJHQHVIRUQRUPDOL]DWLRQRIJHQHH[SUHVVLRQGDWDE\57
T3&5-)LVK%LRO
<RR6.LP++.LP3'RQQHOO\&-.DOLQVNL$/9XSSDODQFKL'3DUN0/HH6-0HULDQGD77
3HUURQH%L]]R]HUR1,7ZLVV-/$+X'=%3ULERQXFOHRSURWHLQFRPSOH[
ORFDOL]HV*$3P51$LQWRD[RQVWKURXJKLWV
XQWUDQVODWHGUHJLRQ$8ULFKUHJXODWRU\
HOHPHQW-1HXURFKHP
=HOHQFKXN7$%UXVHV-/,QYLYRODEHOLQJRI]HEUDILVKPRWRUQHXURQVXVLQJDQPQ[
HQKDQFHUDQG*DO8$6*HQHVLV
=KDQJ=3LQWR$0:DQ/:DQJ:%HUJ0*2OLYD,6LQJK/1'HQJOHU&:HL='UH\IXVV
*'\VUHJXODWLRQRIV\QDSWRJHQHVLVJHQHVDQWHFHGHVPRWRUQHXURQSDWKRORJ\LQ
VSLQDOPXVFXODUDWURSK\3URF1DWO$FDG6FL86$
ϯϬ
=LYUDM.+7XQJ<&3LSHU0*XP\/)DZFHWW-:<HR*6+ROW&(6XEFHOOXODU
SURILOLQJUHYHDOVGLVWLQFWDQGGHYHORSPHQWDOO\UHJXODWHGUHSHUWRLUHRIJURZWKFRQH
P51$V-1HXURVFL
ϯϭ
Документ
Категория
Без категории
Просмотров
2
Размер файла
5 443 Кб
Теги
2017, 1528, jneurosci
1/--страниц
Пожаловаться на содержимое документа