close

Вход

Забыли?

вход по аккаунту

?

Kerrang! - April 28, 2018

код для вставкиСкачать
THE LONGSHOT BIFFY CLYRO
“FOLLOWING IN NIRVANA’S FOOTSTEPS TERRIFIED US”
“WE’VE SPENT THREE YEARS
L I V I N G I N S U R V I VA L M O D E … ”
PARKWAY
DRIVE
A WA L K
WITH THEM
THROUGH
HELL: THE
FULL STORY
ALBUMS YOU
NEED IN YOUR
LIFE NOW!
IHSAHN, C ANC E R B AT S,
QUE E N K WO NG …
EXCLUSIVE
ROCK ICON
POSTERS!
A M Y LEE, TAY LOR
M OM SEN & M ORE
BESPOKE
PARKWAY
PRINT!
FREE A RTWORK
I N SI D E!
£3.00 AUS: $8.95 US: $8.25 K!1719 28.04.18
SURPRISE! BILLIE JOE ARMSTRONG BLASTS BACK!
WELCOME
ISSUE K!1719
APRIL 28, 2018
II’v
’vve b
been
e lu
ee
l cky
k en
noug
ough
h to
to spea
p k
to
o Pa
arkwa
kwa
wa
ay Driv
Dri
r e many
ny
ny,
a y
any
a
y, man
tim
imes
im
es ove
ov r the pas
pa t few
w ye
e
ea
ars,
s but
I’ve
neve
ever hear
eve
ea d them
h
so
ound
n q
quite
I n
lik
lik
ke tthis
hiss. The
h sam
same
e can
n be sai
s d
of
th
heir
w al
a bum
b , Reve
bu
v re
ve
en
nce,,
o the
e r new
e
too
o . But the
then,
n, tho
n,
th se
e two
wo th
h
hing
i s go
in
h d in hand,
han
hand,
a ,a
an
and
nd
d to
o best
besst understand
u
unde
nde
derst
rstand
d their
theiirr epicc
th
hand
and
new recor
ord, you
or
ou
u fi
firstt nee
ed to
to unde
n rstand
an w
and
what the
quintet have
e been
n thr
hrroug
ough
thes
hese past fe
ew years.
q
gh thes
Enter, Ke
errang!
n ’s Emily
y Car
C ter
te an
and this we
w ek’
e s
exc
x lusive
ive inter
te vie
i ww
with
h Wi
Winstton McC
McCall
C l , who
h
e
op ns up
ope
p to Emi
mily
mi
i y lik
k
ke neve
ever befo
efore to
o rev
reve
e
ea the
eal
pain and
nd
d losss they
hey
ha
ave liv
ived
ed thr
throug
ough.
oug
p
y ha
gh
A
As Win
nston
n hims
ims
m elf
e f sa
ay
ys,
s du
durin
ring
rin
g thos
o e ba
ad tim
t es,
havve also
also
o been
b en
be
n moments
m ment
mom
ents
ts of
of light
lligh
igh
ht and
and
d joy
joy,
o
there have
a
and I kno
ow I ca
an spe
peak
k for
for the
th front
frro man w
when
I say
ye playi
yed
ying
yi
y how much they
y enjo
joy
y
g for a
o
handful of competitio
on winners at the
e first evver K!
P live session last m
Pit
month
h. Chec
e k that out over
v on
tthe Kerrang! YouTube
e now – and stay
y tun
u e
ed
d for a
whole lot more…
…
SAM COARE, EDITOR
24
PARKWAY DRIVE “THERE HAVE BEEN SO MANY TIMES WHERE I’VE
BEEN BEATEN SO HARD THAT I DON’T KNOW IF I CAN GET BACK UP”
06
38
BIFFY CLYRO SIMON, JAMES
AND BEN PULL THE PLUG…
J MASCIS MR DINOSAUR JR. ON WHY
HE NEVER BECAME MR NIRVANA…
44
48
54
CANCER BATS WHAT WAS IT ABOUT
LAST WEEK AND SURPRISE ALBUMS, EH?
MOVEMENTS “I REALLY HATE THAT SAD
BOY TREND. IT DISCREDITS MENTAL ILLNESS”
THE LONGSHOT BILLIE JOE’S BACK IN
OUR ROUND-UP OF THE WEEK’S RELEASES
FACT! TAKING BAC K SUN DAY’ S IN FAM O US T HE RE ’ S N O ‘ I’ IN T E AM WAS INS PIRE D BY FRONTMA N A DA M LA Z Z A RA’S LOVE OF JAY-Z , A ND THE RA PPE R’ S THE N-FE UD WI T H NAS
UP C OSE
ENTER SHIKARI befriend the
locals while on tour in Japan…
R
ou Reynolds and the gang might currently
be having a blast on tour in the land of
the rising sun right now, but that hasn’t
stopped Enter Shikari making an impact
back home. At the end of last week, the St Albans
quartet announced two intimate summer shows – that
sold out instantly – proving that home really is where
the heart is. Even if there’s a tiny fan in the beautiful
Hiroshima (pictured here) who seemingly wants to
keep them in Japan just that little bit longer.
KERRANG!
44KERRANG!
Photo: TOM PULLEN
KERRANG!
KERRANG!55
Acoustic Biffy: a real tree-t
6 KERRANG!
THE BIG STORY
(UN)PLUG
IN BABY…
They’ve released double albums, compilations and live EPs. And now
BIFFY CLYRO are throwing another curveball into their collection: an
acoustic record. The band take us inside MTV UNPLUGGED…
words: NICK RUSKELL
Photo: PAUL HARRIES
L
ast year, Biffy Clyro kicked
off the UK relaunch of MTV’s
legendary Unplugged series,
taking to Camden’s Roundhouse
for one of the most important
sets of their career. “Unplugged is such a
big deal to our generation – there’s so many
iconic performances from the ’90s,” smiles
HTQPVOCP5KOQP0GKNTGƃGEVKPIQPJQY
PGTXQWUJGHGNVYJGP/68ƂTUVCUMGFVJG
DCPFKHVJG[YGTGKPVGTGUVGFKPFQKPICUGV
0CVWTCNN[VJGIKIYCUDGCWVKHWNYKVJ
VJG-KNOCTPQEMVTKQFGNKXGTKPIUVWPPKPI
UVTKRRGFFQYPOWUKEURCPPKPIVJGKTGPVKTG
FKUEQITCRJ[6JGTGYCUQPGRTQDNGO
though: for the many thousands of fans
YJQEQWNFPoVUSWGG\GKPVQVJGECRKVCNoU
ECRCEKV[XGPWGKVYCUIWVVKPIVQOKUU
0QYJQYGXGT$KHH[JCXGOCFGWRVQ
VJQUGYKVJ(1/1KPVJGHQTOQHCPCEQWUVKE
.2/687PRNWIIGF.KXG#V4QWPFJQWUG
.QPFQPCUYGNNCUCHQTVJEQOKPIVQWTQH
VJGUGTGPFKVKQPUCTQWPFVJG7-
9GECWIJVWRYKVJ$KHH[VQƂPFQWVJQY
they turned their explosive, festival-crushing
anthems into songs suitable for such an
GPXKTQPOGPVCPFYJCVKVYCUNKMGRNC[KPI
YKVJVJGKTVQRU on for a change…
When did you start thinking about how
to present yourself for MTV Unplugged?
Simon Neil (vocals/guitar): “Immediately
CHVGTYGIQVCUMGF$GECWUGYGoXGRNC[GFC
NQVQHCEQWUVKEUQPIUYGYGTGPoVUECTGFQH
VJGCEVWCNRNC[KPIUKFGKVYCULWUVVQOCMG
KVHGGNTGNCZGFCPFVQHGGNNKMGCUEGPGsC
UGV+VoUCUENQUGVQOCMKPIC68UJQYCU
[QWoTGIQPPCIGV+VoUPQVLWUVCIKIsKVoUC
James Joh
Johnst
hnstton
n (basss): p#PFLWU
L UVVT[KPI
U [ I
VQGPL
VQGPLQ[KV#P
GP Q[
[ KV #P
P VJCV
PFV
J UQWPFUNKMGUWEJC
JC
ENKEJÅDWVVJC
ENKEJÅD
DWVVJC
CVoUU YJ
Y CV[QWoTGVJGTG
[
G
GVQFQ
During
i rehearrsalss you can forget about
VJG
VJGCWFKGPEG
J CW
CWFKG
KGPEG
KG
G CP
PFI
F IGVUVWEMKP[QW
[ WTQYP
W
You’re joining quite the
he gallery
g
y of alu
a
alumni,
mn
ni,,
YGGDWDDN
YGGDWDDNGC
D GC
CPF
F VJ
V GPYJGP[QWEEEQOGQWV
W
aren’t you?
onstag
onstage
ge it’s
it s all
all about that
that connection,
connecttion,
o and
an
nd
Simon: p+MPQY9JGP
PYGYGTGEQPƂTOG
O F
F
that’s really
reall
a y the mai
ma n thing that’s g
gonna
YGOCFGVJGJWIGOKUUVCMGQHYCVEJKPICNNN
OCMGV
OCM
OCMGVJGUJQY
MGV
GVJG
G UJQY
Y6JC
6 VoUOQTGKORQ
RQ
QTVCPVVJCP
C
QWTHCXQWTKVGHWEMKPI7PRNWIIGFUCPFYG
II
YJ
YJG
YJGVJGT[QWO
VJGT[QWO
OCM
C GC
G VGEJPKECNOKUUVCMG
U
QT
YGTGCDUQNWVGN[VGTTKƂG
GF$GECWUGVJGQPGU
P U
UQOGVJ
UQOGVJKPINKMG
V KPINKMG
GVJC
V Vq
VJ
YGPQVKEGFCVVJGVKOGs2GCTN,CO#NKEG
N
N Simon:
on “#PF YG LW
LWUV
WUVFKFGXGT[VJ
FKF GXGT[VJ
GXGT[VJKPI
KPIQPEG
KPI
QPEG
+P%JCKPU0KTXCPC0GKKN;QWPIsVJG[YGTG
G
G
9GTGFKF
G G FKF$W
F F WDD
DDN
D GUCVVJGGPFDG
GU CV V G G F DGECWUG
GECWUG
KORQTVCPVVQWUCVVJGVVKOG$WVVJGP[[QW
UQO
UQOGVJ
G KPI
I YG
YGPV
G VYTQPIYKVJQPG
I
QHVJG
UUJQY
J Y – not
JQY
ott
NQQMDCEMCPF[QWUGGVJCV)GQTIG
J )
/KKEJC
J GN
GN
GN
ECO
E OGTC
GTCU
U $WV
$ YG
$W
G RN
RNC[GFK
F KVCUCUJ
C
CVGNG
VG
GNGXKU
G KUKQP
UKQP
Q UJQ
UJQY
UJ
QY 9G
QY
G YC
YCPVGFKVV
C VGF V VQDGC
VVQ DG C
CPFRGQRNGNKMGVJCVFKFKV'TKE %N
% CRVQP
R Q +VVVoU
O
OQO
QOGPV
QO
G C EQ
GP
EQPPG
Q PG
PGEVKKQP DGVYGGPWUCPFVJG
V VJG
CNNNGXGNUCPFV[RGUQHO
OWUKEUQ VJ
V GTG Y
YC
CUC
C
HHCP
CPU
CP
U RNC
RNC[KPIVVJQU
VJQU
JQ
QUGU
Q
G QPIU+VUJQW
WNFPoV
W
VW
WTP
P
TGCNHGGNKPIVJCVYGJCXXGVQFQCIQQF
I F LLQD
into
i to this
t s reh
ehea
hearsed
sed
6JGHGCTMKEMGFKP
thing,
t
and that’s
t
KOOGFKCVGN[$WV
UQOGVJKPI
U
I VJCVYG
VJGPCHVGTCYGGM
TGCNN[ YCPVG
TGCNN[YCPVG
YCPVGF
GF VQ
GFVQ
QTVYQQHRWTG
CXQKF;QW
C Q F QW YCPVKV
C V V
HGCTYGUWFFGPN[
to be as clo
c ose to
remembered,
perfection
p
as possibl
p
ble
bl
n9CKVYGoXGDGGP
KPVGTOUQH
K VG U Q JQYKV
Q V
CUMGFVQFQKV
sounds,
s
, but even
We can only do
VJGP+HWEM
V
MGFWR
M
R
YJCVYGECPFQo
s ging
sin
g g a couple off
I’d love to be
VKOGUDWV+
V
+YQWNF
+
N CDNGVQUKPINKMG
much
muc rathe
at er
e have
a e
)GQTIG/KEJCGN
SIMON NEIL
that
t at on
o the
t ere
e e than
t a
but I can’t
6JGTGoUNQCFUQH
be try
r ing to
o do
VJKPIYGYKUJYG
som
s mething
g perfect
EQWNFFQCEGTVCKPYC[NKMGC
CHWNNN QTEJGU
JG VTC
VT CPF
C KV PQ
PQVJ
VJCX
CXXKPI
X PI VJCVMKPFQHOCIKEKP
but that doesn’t suit ou
urr ba
band
da
an
nd tthat
hat
att’ss no
ot
o
VJG
VJG CK
C TT 5Q
5 VJC
5Q
CVoU
oUU YJ
Y [V
[ JGETQYFY
Y
YGTTGU
G Q
YJCVYGFQUQ[GCJVJG
JG OCKP VJK
JGOCKPVJK
VJKPI
JKPI
JK
J
PI
I YCU
I
YCU LWUV
LW
WUV
KOR
KORQTVCPV
ORQTVCPV
ORQTV
QTVCP
QTV
CPVsVQ
CP
VQ
QTGO
TGOKPFWUQHYJCV
TGO
TGOKPF
GOKPF WU QH YJCVVYG
GO
YG
YG
G
UVTGCONKKPKPIKVq
I
YGTGF
YGT
YGTGFQKPIq
GF
FQKP
QKPIq
q
FQEWOGPVCVKQPQHWUR
RNC[KPIQPCUVCIG
[ I
I
#PFDGECWUGYGIQUQ
QQXGTVJGVQRYKVJQ
Q QWT
TGIWNCTNKXGUJQYUYGLLWUVYCPVGFKVVQDG
VCUVGHWNCPFMKPFQHUNQYOQXKPIq
“WE WANTED IT TO
BE A CONNECTION
BETWEEN US AND
THE FANS…”
KERRANG! 7
KE
GETTY
Did knowing
D
k
g that it
was
w
as to be released
e eased
afterwards change
g
the tone,, though?
g
S
Simon:
: “We
e did
d d have
a e
t at d
that
discussion
scuss o – ‘Iss itt an
a
a
album?
Is it a gig?
g g What
the
t fuck are we doing?!’”
Ben
B Johnston (drums
d u s):
“It
“ felt more gig-y in the
end,
e
though.
g No feelings
g
of
o a TV show for us,, which
was
w good. We were just
backstage,
b
g came out,
and
a d as soon
soo as we
e did
dd
it
i felt like a g
gig.
g Home
sweet
s eet home.
o e Itt was
as a
shock,
s
though,
g that the
crowd
c o d were
e e too loud
oud
sometimes!
so et es Because
ecause itt
was
w quiet
q
when we’d
been
b
practising,
g and we’d
forgotten
f
that our crowd
are
a pretty noisy, so we came out and went,
‘I
‘ can’t hear a fucking thing.’”
Simon:
S
: “Acoustic guitars aren’t as loud as a
stack
s
of amps! When did that happen?!”
Did it feel strange
g to walk out onstage
g
CPFPQV
CPFPQVJCXGVJCVENCUUKENQWFƂTUVUQPI
JCXGVJCVENCUUKENQWFƂTUV UQPI
I
w
wh
where
here the adrenaline’s kicking
g in?
James:: “Yeah,, it was weird!”
Ja
S
Siimon:: “We missed it like fuck. We reallyy
struggled
s
when we came off. None of us
could
c
sleep properlyy for a couple of days.
y
We’re so used to the adrenaline
l
building
l
up,
up and then we explode
p
at the start off
a gig
g g – but we didn’t have anyy physical
y
l
exhaustion
e aust o at a
all! We
e came
ca e off
o and
a d we
e were
ee
all
a still full of adrenaline and pumped up
for,
f like, 36 hours! It was like we’d just been
shooting
s
g espresso shots or something.
g
James
J
is right, it was weird, because we’re
always
a y exhausted when we come offstage,
g
but
b we weren’t that night because we’re
fucking
f
g sitting
g down. That was the weirdest
tthing about the show – trying to controll the
a
adrenaline without any physical exertion.
We like to come off feeling
g like we’re in
p
pieces, but I was like, ‘I’m fucking ready to
do
d a hundred other g
gigs
g right
g now!’”
James:: “We normally come on with our
tops
t
off and stare down the crowd for the
ƂTUVEQWRNGQHOKPWVGUCPFKVYCUUWEJ
Ƃ
R
C
different
d
thing.
g But it was reallyy exciting
g to
be
b able to do something like this, this far
into
to our
ou career.”
ca ee
Simon:
S
: “I think
t
tthat
at freaked
ea ed tthe
e fans
a s out
out:
‘They’ve
‘
y got
g their tops on?! They’re
y sitting
g
down?!’
d
Everyone was unsettled
l because
we were fully clothed!”
UNPLUGGED’S
GREATEST
MOMENTS
Here’s who BIFFY
have had to live up to.
No pressure, then…
8 KERRANG!
G!
never sure what’s gonna
work – you’ve just gotta
keep trying. Hopefully
we’ve got enough taste
between us that we know
when to… stop trying.”
You did a cover of God
Only Knows by The
Beach Boys. Why?
Simon:p+VYCUVJGƂTUV
dance at mine and
my wife’s wedding!
It’s a song that should
never really be covered
because it’s so good,
it’s perfect. So we were
pushing our luck a slight
bit by doing it! But
once we knew it was
It’s hard to tell with a shirt on, but
for something that was
this really is Simon Neil. We promise
gonna be turned into
an album, I didn’t want
Ben:
e : “It’s funny that we keep saying that:
to just do a good song, or an easy song; it
‘Itt was
as so awkward
a k a d to have
a e clothes
clot es o
on!’”
needed to be something within our bones
S
Simon:
“Yeah, we’ve painted
p
ourselves intto
as a band. I felt that if I was going to do
a corner. Our own scene: topless rock. Or
a cover on a record, it needed to be one
to so rock!”
torso
oc
that’s as important to me as my own songs,
CPFVJCVoUVJGQPN[UQPIVJCVƂVUKPVJCV
How did you
y pick
p
the set list? There are
ar
position for me. So it was brave.”
a few songs
g that seem like a no-brainer
no-brainer,
James: “Really brave!”
but were there any
y you
y tried and playe
played
p y
Simon: “I just fucked off for a day, didn’t I?
around with a bit to see if they’d
y work
work?
I went, ‘I think I’ve got an idea for a cover –
S
Simon:
“Yeah.
ea We
e knew
k e we
e had
ad about
see you tomorrow.’ And thankfully the boys
2 songs
20
g that were g
gonna work, but we
were like, ‘It’s fucking perfect!’”
w
wanted
to try some curveballs.
ll We tried
Ben: “I don’t know how you learned it in
F
Friends
And Enemies and Wolves Of
one day, man.”
Winter, and we tried some early
ly songs,
g
Simon: “I had to learn some new chords!
and
a some just didn’t work. We knew very
Trying to do a Beach Boys song on a fucking
quickly
q
y which songs
g weren’t gonna
g
work.
guitar, man, that’s a tall order! But I’m so
A surprising one was Small Wishes from
glad we did it, because it’s a song that’s so
Ellipsis
E p – that worked an absolute treat.
important to me. And it probably makes the
Bubbles,
B
, I wasn’t sure if that would work
rest of our songs look shit!”
as
a an acoustic track because I reallyy like
to
t strip
p an acoustic version down, but
Were you nervous about it, having so
that
t
felt like a more traditional take on it,,
much meaning for you?
and
a it actually ended up being one of myy
Simon: “Yeah! I practised that one more
favourites
f
from the night.”
than any other. I’d rather make a mistake
in my own song than make a mistake
Was
W it hard knowing
g what to cut?
in that song. It’s the one that was most
Simon:
S
“Well,
ll when yyou’ve lived
l
with song
gs
rehearsed, but onstage I was actually quite
for
f a long time, sometimes they get a wee
e
EQOHQTVCDNG+VJQWIJV+oFDGVGTTKƂGFDWV+
chip
c
on their shoulder. Suddenlyy theyy have
e
quite enjoyed it, and I think the crowd got
this
t thing wrong with them that has nothin
ng
a surprise. And it’s hard to sing along to, so
to
t do with whyy you’re
y
not playing
y g it. I didn
n’t
that was fun for them, I think!”
even
e
mention Bubbles
l – the boys did – an
nd
B
IFFY CLYRo’s mtv Unplugged:
then
t
I went, ‘Oh, fuck – Bubbles!’ The son
ng
L
i
ve At Roundhouse London WILL
Opposite,
O
when we play it as a full band,
BE RELEASED ON may 25. THE BAND
w struggle
we
gg because it’s veryy quiet, but
WILL TOUR THE UK IN september –
w
when we did it acoustically
ll we were llike,
k
see the gig guide FOR INFO
‘Aaah, we’re fucking soaring
s i g here.’
e e You’re
ou e
Nirvana
Might as well start
with one of the most
legendary performances
of all time, right? From the
haunting stage set-up to that
cover of Bowie’s The Man Who Sold
The World, everything about it was
iconic. You can’t say the words ‘MTV
Unplugged’ without thinking of Kurt
Cobain in his cardigan. We’ve tried
– it’s literally impossible.
Alice In Chains
In 1996, having not played
a gig for almost three years,
Alice In Chains returned to the
stage for what many regard to
be Layne Staley’s finest moment in
the latter days of his career, having
been struggling with problems with
heroin addiction. A more
emotionally-charged
Unplugged probably
doesn’t exist.
Pearl Jam
Eddie Vedder is
the king of stunning
acoustic shows these
days. But, at the time
of this recording in 1992,
the grunge titans were still only
starting out. Though the band
claimed they had little time to
prepare for the gig, you’d never
have guessed – it was a spellbinding sign of things to come.
TALKING LOUD
CREATING A
COMMUNITY
IS VITAL
The kinship you build
with your favourite band
can keep them alive, says
THE MENZINGERS’
GREG BARNETT…
WORDS: JAMES MACKINNON
PHOTO: JESSICA FLYNN
“|I
think the music industry has always
been a couple of steps behind what
everyone else is doing to push music
forward. For so long there has been
this idea that it should exist in this rule of,
‘You get a management company, you get
a record label, they put you in touch with
people.’ But fans don’t care what those
gatekeepers say; they care about what’s
important to their community of friends
that they respect. And with the internet,
we’ve been able to break down that hierarchy
of people deciding who has careers and
who doesn’t. We didn’t have any industry
support, so we joined a community and built a
community around us.
“We moved to Philadelphia at a time
when there was a lot of support from this
scene of bands, but I have travelled around
America more times than I can count and we
have played really small towns where there’s
still a strong punk infrastructure. We found
people who wanted to learn how to be a
tour manager or stage tech when we were
w}ÕÀ}ÕÌÜÌLi>ÌÕÀ}L>`°7i
ÜiwÀÃÌÃÌ>ÀÌi`ÌÕÀ}Üi>`>VÕ«iv
amateur booking agents, just guys trying
out booking bands. I remember we were
in Lansing, Michigan and we meet this guy,
Scott, who books us at this place called Mac’s
>À°/iwÀÃÌL>`«>ÞÃ>`ÌiÀi
>À /i wÀÃÌ L>` «>Þà >` ÌiÀi½ÃÃ]i]ÌÜ
i ÌÜ
p
people
p there. So Scott decides, ‘Fuck this, I’m
m
moving
g the show to myy house. I’m g
gonna call
my friends.’ So we move it to his living
g room,
a
and all of a sudden 50 p
people
p come and it
10 KERRANG!
was amazing. He paid us with the rider left by
the band from the night before, which was half a
bottle of whiskey and bunch of cereal. He’s still
our tour manager today! Meeting a dedicated
group of people coming up at the same time
as you is amazing, because everyone is in it
together and inspiring each other.
“The music means so much to people and
they see how hard it is for DIY bands who are
basically starving on the road. They may not be
able to buy a record, but they want to do what
they can to ensure the art they love continues to
exist. As a fan, engaging with bands online is a
huge morale boost for them, as is turning up to
a show at any level. And if you have a group of
friends that want to start a zine, print T-shirts or
start a record label, you can do it anywhere. The
internet has completely changed all of that and
there’s a plethora of information online of how to
do that. Do what you’re good at and whatever
ëÀiÃÞÕ]ÞÕ½w`ÃÕVViÃÃÌ>Ì>`
inspire others. I really believe that.”
THE MENZINGERS PLAY REBELLION FESTIVAL ON
AUGUST 2, AND LONDON’S O2 FORUM KENTISH
TOWN ON AUGUST 3. SEE THE GIG Guide for info
“FANS CARE ABOUT
WHAT’S IMPORTANT
TO THEIR COMMUNITY
OF FRIENDS”
G R E G
B A R N E T T
INSTANT EXPERT
What’s this? Oh, just Justin
Hawkins celebrating some
exciting THE DARKNESS
news. Here’s the lowdown…
1
2
3
THEY’VE ANNOUNCED IT WAS CAPTURED
THEIR FIRST-EVER
LAST DECEMBER AT
LIVE ALBUM
THE EVENTIM APOLLO
For the best part of the
’00s, The Darkness made
a name for themselves
as one of our fair isles’
greatest live bands. But
they’ve never actually
documented this
properly… until now.
Enter: The Darkness –
Live At Hammersmith,
which will be released on
June 15 through Cooking
Vinyl. About time, guys.
The band welcomed in
the festive period in
the best possible way
in 2017, headlining
London’s Apollo on
December 10 as part of
their Tour De Prance.
And yes, even though
it was 15 days before
the special day, they still
played that Christmas
hit. All together now:
‘Don’t let the bells end!’
THE TRACKLIST
IS ABSOLUTELY
MAGNIFICENT
4
JUSTIN HAWKINS
SAYS THIS ABOUT
THE RELEASE…
5
THEY’VE ALSO
RELEASED THE LP’S
FIRST TRACK…
6
AND THEY’RE TOURING
WITH HOLLYWOOD
VAMPIRES
Nineteen songs – each
and every one a banger
– spanning The Darkness’
iÌÀi`ÃV}À>«Þw`
themselves on Live At
Hammersmith. And from
Open Fire (taken from
2015’s Last Of Our Kind),
through to set-closer –
and 2003 breakout hit –
I Believe In A Thing Called
Love, it’s sing-alongmeets-spandex central.
“This is your opportunity
to possess the experience
of The Darkness Live,”
the frontman reveals, “as
perceived by your ears,
leaving your eyes free to
scan the road ahead for
obstacles, or to watch
Emmerdale with the
sound off, or to mould
clay, or to darn socks.”
Um, sure, we’ll get
right on that…
To coincide with the
news, The Darkness have
unveiled a hip-shaking live
rendition of Buccaneers Of
Hispaniola, taken from last
year’s brilliant Pinewood
Smile. Spoiler alert: if you
like this version, you’ll dig
the whole album.
Just one day after Live
At Hammersmith’s
release, the quartet
will be hitting the road
supporting supergroup
Hollywood Vampires.
Not a bad way to kick
off their next chapter
at all, then.
The Darkness – Live At Hammersmith is
set for release on june 15 via cooking
vinyl. see the gig guide for tour dates
PANDORA BY RAY ZELL
R AY Z E L L .C O M
KERRANG! 11
ACCESS ALL AREAS
As they announce a headline
UK tour, PHIL CAMPBELL
AND THE BASTARD
SONS invite K! into their
rehearsal room. Thank God
we brought our earplugs…
12 KERRANG!
“W
Words: PHIL ALEXANDER
Photos: NADINE BALLANTYnE
hen we rehearse
we usually
play one song,
have a massive
argument, and then we all piss off!” Phil
Campbell grins. Thankfully, the band’s
temperamental side stays hidden as K!
travels to their Cardiff rehearsal room to
ƂNO VJGO DNCUV VJTQWIJ COKPWVGUGV
As Phil arrives – long after the band
have set up and late, as usual – in a room
further down the hallway a covers band
can be heard running through a version of
David Bowie’s Heroes (ironically one of the
last songs Phil recorded with Motörhead).
Tragically, Lemmy’s passing on December
28, 2015 brought Phil’s 32-year tenure
in the band to a sudden end. “I really
wasn’t sure if I wanted to carry on,” he
admits. Solace came in the form of a band
he’d initially founded to play a couple of
parties, the line-up consisting of his three
sons – Tyla (bass), Todd (guitar) and Dane
(drums) – alongside frontman Neil Starr.
Originally named The All-Starr Band, they
rechristened themselves Phil Campbell
And The Bastard Sons in the summer
of 2016. “The name sounded suitable!”
he chuckles. Since then, they’ve toured
relentlessly, grafting hard to support their
debut album, The Age Of Absurdity.
“We’re at a point now where we’ve got our
own audience, which is great,” says Phil.
“But we’ve worked hard for that.”
That hard work tends to start in the
rehearsal room, where the volume is
excessive and the humour unforgiving.
Watch what happens for yourself by
checking out Phil Campbell And The
Bastard Sons’ band practice exclusively on
Kerrang!’s YouTube channel now, and read
a full interview with Phil at Kerrang.com. K!
KERRANG! 13
Wolf Culture just came
out of the blue
AMPED UP
9
Pop-punk from the South Coast
with hidden depths…
T
hough it does have a beach,
“These songs capture how I felt
Bournemouth, with its ageing
>Ì>ëiVwVÌ
i
Þvi]»Ìi
population and endless rows of
£Þi>À`vÀÌ
>iÝ«>ðº
seafront hotels, is not an obvious
Ü>Ìi`Ì>««ÀiV>ÌiÌiV>}i]
breeding ground for pop-punk. It does
Ì>ÌÌ}Ã>ÀiLiÌÌiÀ>`Ì>ÌÌi
give you a desire to escape, though, as
people in those situations are still
Wolf Culture singer Max Dervan explains.
iÀi°9ÕÃii>Ìv}`Ì}Ã
ºÕÀi
ÕÌ
vi]LÕÌÞÕ
ÃμÕÌi>ÃiÌiÀi`
also see a lot
VÌÞ]»>`
ÌÃ>Ý°
vL>`°»
ºƂ`Qi>ÀLÞÃÕLÕÀLR
Along with
}Vvvi]ÜiÀi
`iÌ>}
}ÀiÜÕ«]Ã>«VÌÕÀi
push-pull
perfect village where
À
>ViÃ
Ìi«i«i>Ài
ÃÌÞ
opening track
i`iÀÞ°À
i]L>`Ã
7ÀiV]>Ý
i>"ÕÌÞÜiÀi
`iÌ>Ã`>ÀiÀ
M
A
X
D
E
R
V
A
N
>}
«Ãiv>Ü`iÀ
iÝ«iÀiViÃ
ÜÀ`ÕÌÌiÀi°»
growing up on
*iÀ>«ÃÌ>̽ÃÜÞ
ÌiÌð
7v
ÕÌÕÀiq>Ý]Ã}ÕÌ>À«>Þ}LÀÌiÀ
Hinting at abusive relationships
>Þ]L>ÃÃÃÌÃ>LiÀÌ>``ÀÕ
iÀ>i
>`Ãiv>À
­¼/iÃV>ÀÃÞÕÀ
>iÃq`½Ì`À>ÜÌiÌÞ«V>«««Õ
ÜÀÃÌÃÌi
ÀiÌÀÕÌÌ>ÞÕÀ
ÌÀ«iÃÌiÀLÌÌiÀÃÜiiÌÃ}ð,>ÌiÀÌ>
«ÃiÛiÀVÕ`½®]i iÝ«ÀiÃ
>i`iÃÃÃÕ
iÀ]>ÝÃiiÃÌi vÕÀÃ}Ã
the feelings of powerlessness in
Ì>Ì
>iÕ«ÌiÀ`iLÕÌ*]/iiÛ½Ã*>Ã
Ü>ÌV}Ã
iiÃÌÀÕ}}i°
À`i>`Ã]>Ã>iÌiÃ>`°
ºÌ½ÃÌÌi`i`ÌLi>Ã>`
wordS: JAMES MACKINNON
“I HOPE OUR SONGS
CAN HELP PEOPLE.
THEY HELP ME…”
14 KERRANG!
GET TO
KNOW
Your quick guide
to WOLF
CULTURE
THEY ARE:
Pop-punk crew
with emotional
smarts to match
their big hooks.
HEAR: Continents,
from their
debut EP The
Devil’s Plans For
Idle Hands.
SEE: The ultracolourful video
for single, Wreck.
MORE INFO:
Facebook.com/
wolfcultureuk
Ã}]LÕÌÌÃÌi`i`ÌLi>
v>VÌÕ>Ã}]»iÃÌ>ÌiÃ]Ã
«Þ°
ºiÛiÀiÌ}ÛiÌ
ÕV
>Ü>Þ>LÕÌÜ>ÌÌiÞÀVÃ
i>]LÕÌÜ>Ìi`Ìëi>ÕÌ
LiV>ÕÃiiÃÕ`ÃÕvviÀ
ÃiVi°«iÌV>i««i«i°
Ì`iwÌiÞi«Ã
i°
º7iVÕ`Li`vviÀiÌL>`Ã
ÜÌÃ
ivÌiÃiÃ}Ã]ÜV
Ü>ÃÌiÌiÌ°/i w>Ã}]
/i -`ivviVÌÃ"vi}>««Þ]
Ã>>
>}>
>Ìv iÛiÀÞÌ}
viÌLi}>Ìii>}iÀ>Ã
>
ÌÜ]»iÃ>ÞÃ]LivÀiVÕV}
>`>``}]ºÜVÃ>LÕÌ>Ã
«««Õ>ÃÌ}iÌÃt»
*iÀ>«Ã]LÕÌÜÌi
Ì>Þ
ÛÛ`Ã}ÃÌ>Ì>Ài>VÕÌ>LÛi]
Wolf Culture aren’t going to be
ÃÌ>Þ}ÌiÀÃ
>Ãi>Ã`i
ÌÜvÀ}°
WOLF CULTURE’s EP THE
D E V I L’ S P L A N S F O R I D L E
HANDS IS OUT ON MAY 11
VIA COMMON GROUND
NEW NOISE
NOW HEAR
THIS
BRYAN GARRIS
of KNOCKED
LOOSE takes
over our new
music round-up!
I
`½ÌÌi`ÌvÀiÜL>`Ãq
VL>VÀƂÀ>}i]>`i iÃi
`vÃÌÕ
Li>VÀÃÃÌi
]>`
Ã`}Ì>Ì°/iÞ½Ài>ÃÌÀ>}Ìi`}i
ÕÃÕ>Þ̽Ã>L>`½ÃÛiÃÜÌ>Ì
L>`]>`Ài>ÞÀiëiVÌÜiÃÌ
ÃiÃ
i°"ViÌiÞ½Ûi}À>LLi`
Þ
>`ÛÕiÀ>LiÌiÀÛV>ÃÌÃÜÌ
ÌiÀiÃÌ]½}ViVÕÌÌiÀÀiVÀ`i`
ÃÞÀVÃ]LiV>ÕÃi½`>Ü>ÞëÀiviÀÌ
ÃÌÕvv]>`½
loving>vÌiÃiL>`Ã
i>ÀÃ
iiÌ>}>LÕÌÃ
iÌ}
À}ÌÜ°
«ÀÌ>ÌÌÌi
ÃÌi>`vÜ>ÌÌiÞ
ÀÃÌÕ«ÃSanction]Ü>Ài vÀ
ÌÌiÞÃÕ`ÜÀÌi°
}Ã>`]>`ÀiViÌÞÃ}i`ÌÕÀ
>ÛiÌ
iÌ Inclination]LÕÌÌ
>Li]*ÕÀi Ãi°/iÞ½Ài>ÃÕ«iÀi>ÛÞ
ÕÃÌLiV>ÕÃiÕÀ}ÕÌ>À«>ÞiÀÃ>>VQ>iR
L>`]>`ÜiÃÌiÌÌi
}iÌ
>ë>ÞÃÌiL>`°/iÞ½Ài>ÌiÀ
Ài>ÞÃÌ>}V]LiV>ÕÃiÌiÞÃÕ`i> ÃÌÀ>}Ìi`}iL>`]>`ÜiiÛiÀ
`i>ÌVÀiL>`ÞÕÜÕ`>Ûi vÕ` i½ÃÌLÕÃÞÜÌVi`Ãii½Ã
Þ-«>ViL>VÌi`>Þ]ÜVÃÜ>Ì
vVÕÃ}Ì>Ì]>`ÌiÞÀii>Ãi`i
wÀÃÌ}Ì
iÌi>ÛÞ
v
Þv>ÛÕÀÌiÀiVÀ`Ã]
ÕÃV°/iÞ½Ài>}Ài>Ì
`ÜiÃÌ-ÌÀ>}Ì`}i]
ÛiL>`]>`Üi
v>ÃÌÞi>À°/iÀ
ÕÃV
ÌiÞ½ÀiÌÀiÛiÌ}
>Ã`v>¼äÃÛLi]
>ÞÌ}]ÌiÞ½Ài`}
̽ÃÛiÀÞÃÌÀ>}ÌvÀÜ>À`
ÌiÀÌ}Ài>ÞÜi]
>À`VÀiÜÌ>Ì
>`ÌiÀÀiViÌ>LÕ
]
v
iÌ>q>`ÜÌ
/ivÀ}i
iÌ"v
ÌiVÀÕëi`>
`½Ã*>Ãso}`°
ÌiÜiÌ
i°/iÞ
/i½`>Ûi
«>Þi`ÌiÀwÀÃÌÃÜ
B R Y A N G A R R I S
Ì«V >ÃÛi½Ã
at the beginning of
Chamber]Ü>Ài
iLÀÕ>ÀÞ>äV>«
ÃiÜÌiÞ½ÛiÞ
«ââ>ÀiÃÌ>ÕÀ>Ì]>`
>VÌÕ>Þ«>Þi`>viÜ
it was iÛiÀÞÌ}ÞÕ
ÃÜÃ>`ÌV>Li
VÕ`Ü>ÌvÀ
>
>À`Ìw`>ÞÌ}
>À`VÀiÃÜ°
>LÕÌÌi
i°
½
>Ã}}Ì
½`V
«>ÀiÌi
Ì
have to talk about
i>ÀiÀ
ÛiÀ}i]LÕÌ
Higher Power vÀ
ÀiViÌÀi`>ÀÕ`
Ìi 1°½`iÛiÀ
LÀi>`ÜÃ]>`
ViVi`Ìi
ÕÌ
Chamber Moved
ÌiÀi½ÃÌ>Ì
Ài
LivÀiÜiÜiÀiÕVÞ
during the picture
V>Ã>Þ>LÕÌÌi
]
enough to tour with
LÕÌÌiÀ`i
ÌÌ>Þ
Ìi
>ÃÌÞi>À]>`
Ì
iLÞÃÕÀ«ÀÃi]
ÌÌ>ÞviÛiÜÌ
>`ÌÌiÞ
ÌiÀ
ÕÃV]ÌiÀÛi
VÕ`Ài>ÞLÀi>
ÃÜ>`Ìi«i«i
ÕÌL}ViÌiÞ
ÌiL>`°/iÞ>Ûi
ÃÌ>ÀÌÌÕÀ}«À«iÀÞ°
>9>ÌÌÌÕ`i>`ÌiÞ
Having taken Year
V>ÀiÃ
ÕV>LÕÌ
Of The Knife out
iÛiÀÞÌ}Ì>ÌÌiÞ
on our spring tour
`]>`iÌ>ÌÌiÀ
Ì«ÀL>LÞܽÌ
singer is bringing a lot
surprise people that
v
i`ÞÃÛV>Ã
Sanction:
iÌÌi
]LÕÌ
Üii>ÀÞiÛiÀÞi
Really, really cross
iÃi>À`VÀiÃ
ÃÌ>`Li`Ì>ÌL>`
ÃVÀi>
}>`Þi}
Üii>ÀÌi`Þ°ƂÌ
>ÌÌi
iÌ°
iV
vL>`Ã>Ài vVÕÃi`
Ìi
ÕÌt
on the resurgence of
`iÀ
iÌ>VÀiÀ}Ì
BRYAN AND knockeD
Ü]>`ÌiÞ>ÀiÌ]
loosE play download
LÕÌÌiÞ½Ài«ÕÌÌ}>
in june – SEE THE
ÕÀ«i>ëÌ]
GIG GUIDE FOR INFO
ÃÕ`}`vi
“I SAW INCLINATION
IN A PIZZA
RESTAURANT!”
ROCK CHART
G
GHOST
are
a
ascending to
h
high places.
None more
N
iimpressive than
an
tthe top of our
unholy chart…
u
…
ARTIST
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
GHOST
PARKWAY DRIVE
MØL
THE LONGSHOT
SVALBARD
FIVE FINGER DEATH PUNCH
NCCH
THE FEVER 333
BURN THE PRIEST
JONATHAN DAVIS
HAGGARD CAT
CODE ORANGE
STAND ATLANTIC
ENTER SHIKARI
ZEAL & ARDOR
THE WONDER YEARS
MIKE SHINODA
CARPENTER BRUT
GROUNDCULTURE
JUDAS PRIEST
BULLET FOR MY VALENTINE
TINE
GHOST:
Ready for the beach
TTITLEE
RATSS
WISHING
W
ISHING WELL
WELLS
LS
LS
BRU
RUMA
M
BOD
O Y BAGG
REVENGE
GE PORN
ON
FAK
FAKE
AE
MADE AN AME
M RICA
RC
INH
NHERIT
NH
N R THE EARTH
AART
EVERYONE
O
BAD NEWSS
ONLY ONE
O E WA
WY
CHE
CH MICALS
C S
TAK
A E MY COU
O NTRY BAC
ACK
GGRA
R VEEDIGGER
GGE ’SS CHAANT
SIS
SISTEER CITIES
C ES
CRO
CROSS
SSINGG A LINNNE
BEW
E ARE THE BEASST
CON
COO FEESSIO
SS ONS
NS
FIRREPOW
O ER
OVER ITT
NW
NEW
V
W
NW
NEW
W
W
W
¥
V
NEW
V
W
NW
NEW
W
W
W
W
V
W
W
SUBSCRIBE TTOO TH
THE
H E KERRANG!
KEE R RAN
RRAA N G !
ROCK CH A RT O N S P O T I F Y
Open your app, hit th
he search
hb
bar, and
bar
d ho
over
er yyour
ode
camera ovver the follo
f owing
g code
Higher Power:
Always forgetting
their basketball
KERRANG! 15
LIFE IS HEAVY
THE FIRST SONG I
REMEMBER HEARING
THE
HIPPOPOTAMUS
SONG
FLANDERS AND
S WA N N ( 19 6 0 )
“Even if you’re
not familiar
with their work, you’ll have heard
of this song. It goes: ‘Mud, mud,
glorious mud / Nothing quite like
it for cooling the blood.’ They’re
a group who I’ve come back to
much later in life, but my mum
and dad used to play this in the
car incessantly when I was young.”
THE SONG THAT MAKES
ME THINK OF CHILDHOOD
A DAY IN
THE LIFE
T H E B E AT L E S ( 19 67 )
“My parents
didn’t really
believe in
or have any
knowledge
k
or awareness of
popular
p
music, but I feel like
they probably decided to buy a
Beatles album for us kids. I can
remember Sgt Pepper being on
quite a lot, and A Day In The Life
in particular.”
THE FIRST SONG I
FELL IN LOVE WITH
MURDERS
IN THE RUE
MORGUE
Words: MISCHA PEARLMAN
PhotO: Paul Harries
I R O N M A I D E N ( 19 81 )
“Technically,
I should
probably say
The Ides Of March, which comes
before this song on Killers. The
light-switch moment in my musical
development was getting hold of
a copy of this album when I was
about 10 years old. My life divides
into before and after that. It was
ÞwÀÃÌiÝ«iÀiViv
iÌ>>`Ì
Ü>Ã`v
ÞwÀÃÌiÝ«iÀiViv
any kind of rock music. A friend of
mine’s older brother had an Iron
Maiden poster that I thought was
cool so I got one of the cassettes
and put it on. I had no idea what
was coming and the switch just
y««i`
Þ
`°»
THE SONG THAT INSPIRED
ME TO BE IN A BAND
SERVE THE
SERVANTS
N I RVA N A ( 19 9 3 )
“After I got
into metal,
I got into
various other
bits and bobs, and Nirvana were
a huge deal when I was, like, 12
years old. I enjoyed Nevermind
but there was something about In
16 KERRANG!
BIRTH.
SCHOOL.
ROCK.
DEATH.
Some might say he’s the antichrist,
but punk-folk rabble-rouser FRANK
TURNER just wants to make people
dance – when he’s dead…
Utero that made me want to be in
a band. It sounded like the kind of
noises that I could make because
it was so raw and so unprocessed,
sonically. I could pick any song off
this record, but when that opening
track hit, it immediately made me
want to be in a band.”
THUNDER ROAD
BRUCE SPRINGSTEEN
( 1975 )
“I have to
pick this one.
It’s just such
an incredible
piece of literature and it’s an
i`iÃÃÞV
«iÝ«iViv
music. And it doesn’t really have
a chorus, which I love. Bruce was
only 25 years old when he wrote
it, which is madness.”
THE FIRST OF MY SONGS
I HEARD ON THE RADIO
SMILING AT
STRANGERS
ON TRAINS
MILLION DEAD (2003)
“This is a
wonderful
memory. When
n
I was in Million Dead, we sent a
copy of this to John Peel at the
BBC. We tuned in the following
Monday to listen to his show and
he opened it with our single. We
thought that maybe somebody
had accidentally switched over to
the CD player and pressed play.”
THE SONG THAT REMINDS
ME OF MY FIRST LOVE
LOVELETTER
TYPEWRITER
M I N E R A L ( 19 9 8 )
“This is cheesy,
but I was so
obsessed with
Mineral, and
in particular with EndSerenading,
>`
ÞwÀÃÌ«À«iÀ}ÀvÀi`>`
I used to listen to that record a lot
and sort of believed that love was
perfect and real and tangible and
all the other kind of things you
believe as a teenager.”
THE SONG I’D LIKE
PLAYED AT MY FUNERAL
THE FIRST SONG I EVER
LEARNED TO PLAY
SHEEP GO
TO HEAVEN
KNOCKIN’ ON
HEAVEN’S DOOR
CA K E ( 19 9 8 )
B O B DY L A N ( 1973 )
“It sort of
pains me to
admit that this
Ü>ÃÌi wÀÃÌ
song I learned, and at the time
I thought it was by Guns N’ Roses.
But it only has three chords in it
and so when I learned those I felt
like I had mastered the song. And
this was before I even had my own
guitar – a guy at school let me
play around on his. I’m not sure
it sounded particularly good and
I’m guessing it probably didn’t,
but the three chord shapes came
easily enough to me.”
THE SONG I WISH
I HAD WRITTEN
THE SONG THAT GOT
ME INTO TROUBLE
GLORY HALLELUJAH
FRANK TURNER (2011)
“This was an attempt to write an
atheist hymn; to put forward a
positive case for it because I feel
̽ÃμÕÌivi>vwÀ
}°½
Ì
interested in converting the world,
but some people got irritated
about it. We had a religious picket
outside a show once. One guy
was shouting, ‘Frank Turner is the
antichrist!’ which I enjoyed.
antichrist!
enjoyed ”
“Like most
music nerds,
I have an
iÝÌiÃÛi
funeral playlist coming together,
LÕÌÌi>LÃÕÌi w>Õ
LiÀ>Ã
got to be this. It’s a fantastic song
about how life is short and I’d like
people to put on their dancing
shoes when I die.”
BE MORE KIND IS SET FOR
RELEASE ON MAY 4 THROUGH
XTRA MILE / POLYDOR.
FRANK TURNER IS ON TOUR
IN THE UK NOW – SEE THE
GIG GUIDE FOR INFOrmation
“ONE GUY SHOUTED,
‘FRANK TURNER IS
THE ANTICHRIST!’”
F R A N K
T U R N E R
How to get those pesky
dropped picks out of
your guitar, step #1…
KERRANG! 17
NO-ONE KNOWS…
“I ALMOST
PUKED ON
MANSON’S STAGE”
Delving into ASH
COSTELLO’s mind
was never going to
be a fun ride. Here’s
hoping Disney don’t
pay a visit to the
NEW YEARS DAY
singer’s house…
I’M A CLASSICALLY
TRAINED BALLERINA
“I was a professional dancer for
a long time: I worked as a dancer
at Disneyland, which, aside from
Broadway, is one of the hardest places
to get a job in that industry. The
audition process is really gruelling –
thousands of people show up for about
30 roles. I danced there for nearly a
decade, and it’s where my performance
UMKNNUCPFEQPƂFGPEGEQOGHTQOq
MY GRANDMA WAS A
PRACTIsING WICCAN
“My family has always been strange
– we’re very horror-oriented. When
you grow up with a grandma who’s a
practising Wiccan and two uncles who are
quintessential ’80s goths, your knowledge
of horror movies starts at a very young
age! I’ve channelled that into our
aesthetic, which I see as a mix of Disney
and The Texas Chain Saw Massacre.”
I WANTED TO CREATE
THEME
PARKS FOR A LIVING
“I left Disney to work at another theme
park [in California] called Knott’s Berry
Farm. I helped build the mazes and
scenery. Had New Years Day not been a
success, that would’ve been the career
I pursued. I have a friend who builds
attractions and he makes an incredible
NKXKPIHTQOKVq
I KISSED SOMEONE IN
A HOLLYWOOD MOVIE
“One of the last acting roles I had was in
the background of Kristen Stewart movie
[and Joan Jett biopic] The Runaways, and
all I had to do was make out with a guy in
the background. I guess you’ve got to start
somewhere! To be honest, I suck at acting.
When we do videos, I warn the director
that I can’t act!”
MY BIGGEST REGRET IS
LACKING CONFIDENCE
WHEN I WAS YOUNGER
“I always think about how much further
along I’d be in my career and in life if I’d
LiiVw`iÌ>Ì>i>ÀiÀ>}i°ÀÞi>ÀÃ
I held myself back, and there was no need
for me to have so much self-doubt. I’m a
late bloomer in the music scene because of
it, but I believe that everything happens for
a reason, so I don’t dwell on it too much.”
NEW YEARS DAY’S DIARY OF A CREEP
COVERS EP IS OUT NOW VIA CENTURY
MEDIA RECORDS
18 KERRANG!
Words: JAKE RICHARDSON
/CPUKQPVJGƂTUVTQQOKUVJGn5VTGVEJKPI
Room’, which has paintings that stretch
out to reveal something sinister. I’ve
just acquired four large ones that I’m
going to hang up in my house. There’s
this whole black market of Disney
memorabilia that I wasn’t aware of until
recently. It’s kind of terrible, but I’m
UVQMGFVQJCXGVJGUGRCKPVKPIUq
PHOTO: PAUL HARRIES
I OWN THE ‘STRETCH’
PAINTINGS FROM DISNEY’S
HAUNTED MANSION
“When you go into The Haunted
COOL STUFF
MUST
HAV£S
The only things
you need to spend
your money on
this week…
If you’ve not heard Carpenter Brut yet,
just imagine exactly how this T-shirt sounds,
and you’ve pretty much got it.
€20 (£17) Noquarterprod.com
&VEZIXLIMRIZMXEFPIGEQSY¾EKI
jokes and this handsome
coach jacket from Huf shall
be your reward.
£74.99 Routeone.co.uk
The original Doom game soundtrack comes
to vinyl, so now your record collection can
include music to mash zombies to.
£29 Lacedrecords.co
SStreeetwear
brand Obey has teamed up with
e
½ J
T
] T
XL
XLI1MW½XWJSVEWTSSO]GETWYPIGSPPIGXMSR
This satin bomber is our pick
p off the bunch..
£
£110 Obeyclothing.co.uk
y
i g
k
This year marks three decades of Pennywise.
If that doesn’t warrant a T-shirt, we don’t
know what does.
€17.50 (£15) Eu.kingsroadmerch.com
This patchwork backpack
backpaack from Hype doesn’t
have a clue what it’s doing, but still manages
to look great.We respect that.
£24.99 Routeone.co.uk
T
These
UA
U Mid Skool
oo DX Anaheim
a
F
y shoes frrom Vans are like the
Factory
cchunky big brotheer to your Old
O Skools..
S up some hanggs with your feet
f asap..
Set
£65 Oip
polloi.com
m
If you want clothing that ticks both the ‘cool’
and ‘utterly terrifying’ boxes, then Nature
World has you covered with this crew neck.
£64 Shop.thehyv.net
20 KERRANG!
GET
KERRANG!
TO YOUR
DOOR
ANYWHERE
IN THE
WORLD
N E W S STA N D.C O.U K / K E R R A N G
SAT
08 DEC
MON 10 DEC
TUE
11 DEC
LONDON THE SSE ARENA, WEMBLEY
BIRMINGHAM ARENA
MANCHESTER ARENA
L I V E N AT I O N . CO. U K
•
T I C K E T M A S T E R . CO. U K
w w w. n i g h t w i s h . c o m
A L I V E NAT I ON P R E S E N TAT I ON BY A R R AN G E M E N T W I T H T I L L DAW N T H E Y COU N T
WINNER!
AWESOME AWSTEN
“Awsten Knight from Waterparks!” says
@monzartstudio. We think this is really
cool. So much so that you’ve won a pair of
tickets to Marmozets’ UK tour. Hit us up at
Feedback@kerrang.com to claim your prize.
SO AND TROUBLE
SOIL
ROUB E
“
“Me
and the lead singer
g of SOiL,” says Emily
E ly
y
B
Beerling.
l g.
g Yes. Yes it is, Emily. Thanks for sending
g
tthis in. Although we really hope
p that you and
R
Ryan
manage
g to unstick your faces before the
band’ss next tour.
band
tour
KOMMUNITY
RAT’N’ROLL
Your pics, your art…
your lives
“My little Bob with his favourite magazine,”
says @annixshoes. Sure, on the one hand, the
ÌÕ}Ìv>}>Ì]
ÌiÀ>ÌiÀ>Ì`iÃw
ÕÃÜÌ
terror. But, on the other, we can’t argue with
his taste in reading material.
CARTOON
KURT
“I drew this cartoon
of the late, great Kurt
Cobain as a tribute to
him, as last week was
the 24th anniversary of
his death! Hope you like
it,” says Daniel Price.
/ÃÃ`iwÌi
Þiv
the grungiest drawings
of Kurt we’ve ever seen,
Daniel. An awesome
tribute. Thanks!
CHESTER TRIBUTE
“This is a tribute piece to Chester
Bennington. I’ve grown up with
Linkin Park, and when I heard the
awful news I was heartbroken,”
says Leah Jade. A very moving,
colourful portrait. Thanks, Leah!
N E X T
W E E K
WIN TICKETS
TO SEE AS IT IS
FALLEN FANS
ºÞw>Vj>`iÌ
Evanescence in Nottingham,”
says @EternalRemorse. Excellent!
Except now we really want a cape
à la Amy Lee.
22 KERRANG!
WE ARE THE GRIN CROWD
“That time I met Sainte in Edinburgh,” says
@Snakes42. Thanks for sending this our way.
7i½Ài`iwÌi
Þv>ÃvÌiÜ>ÞÞÕ½Ài«
>Þ}Ì
much cooler than Tay. Top work.
Kerran
ng! have teamed up
w
with th
he dudes in As It Is
tto offer a pair of tickets to
ttheir upcoming
g ‘‘An Evening
g
W
co
c tour.
o
With As It Is’’ acoustic
T
The intimate shows
o will
ssee the
e Brighton
g
pop-punk
q
quarte
et stripping
g back fan
ffavourrites, interspersed
p
with co
onversations
w
e
o about
o
ttheir
e tiime
e as a band to
o date.
e
T
To be in with a c
chance off
n
nabbing the tick
k
kets, we
n
need y
you to twe
e
eet y
your
c
coolest rockstarr selfies and
artwork with the
e hashtag
g
#
#Kommunity,
y orr email
tthem over to Fe
e
eedback@
@
k
kerrang.com.
g
Fo
or more
iinformation abo
o
out the tour,,
visit Asitisofficia
al.com.
v
o ca
co .
TA K E
THE
LEAP
SU SC
& SAVE 1/3
T ee o s of
rock’s greatest
g
f
£22 25
Kerrang.imbmsubscriptions.com
01293 312213 (Promo code: 3months)
T&Cs: Subscriptions will start with the next available issue. Prices quoted apply
when you pay by recurring payment every three months. One-off payment methods
also available – see website for details. You will not receive a renewal reminder and
the recurring payments will continue to be taken unless you tell us otherwise. This
offer closes on 07/06/2018. This offer cannot be used in conjunction with any other
offer. Cost from landlines for 01 numbers per minute are (approximately) 2p to 10p.
Cost from mobiles per minute are (approximately) 10p to 40p. Costs vary depending on the geographical location in the UK. You may get free calls to some numbers
as part of your call package – please check with your phone provider. Order lines
open 9am – 5pm (Monday – Friday). UK orders only. Calls may be monitored or
recorded for training purposes. For full terms and conditions please speak to: kerrang@subscriptionhelpline.co.uk.
24 KERRANG!
COVER STORY
T H E
E D G E
O F
T H E
A B Y S S
WINSTON MCCALL isn’t exaggerating when he says that
the past three years have been the worst of PARKWAY DRIVE’s
lives. But as the world began to fall apart around them, new album
REVERENCE – and their unbreakable, brotherly bond – soon
became the only things that could pull them through…
Words: emily carter
Photos: andy ford
KERRANG! 25
live photO: getty
E
26 KERRANG!
G
very evening, Winston McCall
watches the sunset. “I’m
awake as often as I can be
to watch the sunrise, too,
and I’m so grateful I get to
see that – to see another
FC[q JGUC[UCU JGTGƃGEVU
on soaking in each passing
rotation of the earth. “I don’t think that’s
ever going to leave for the rest of my life.”
You could forgive the Parkway Drive
frontman for doing this simply because his
home surroundings – the beautiful Australian
beachside town of Byron Bay, encompassed
by a clear-blue ocean and sweeping skies –
provide the perfect set of conditions to witness
the sun edge closer towards the horizon, until
it peacefully slips away for the night. Winston,
though, has been given – or rather, had forced
upon him – a whole new appreciation of his
existence. And though he doesn’t strike you as
a man who has ever taken anything for granted,
a series of devastating,
life-changing events over
the past three years have
focused him into never
wanting to waste a
single second again.
From the outside looking
in, you wouldn’t have
guessed this. His social
OGFKCRTQƂNGRQTVTC[UC
man exploring the globe
and relishing its natural
beauty with a smile as wide
as anything plastered across
his face. His career, too,
is similarly thrilling. Since
the release of Parkway
Drive’s boundary-pushing
ƂHVJCNDWO+TGTGNGCUGFKP
September 2015, the Aussie
ƂXGRKGEGsEQORNGVGF
by guitarists Jeff Ling and
Luke Kilpatrick, bassist Jia
O’Connor and drummer
Ben Gordon – have done
what they always threatened
to: become one of heavy
music’s biggest and most
important bands. For the
ƂTUVVKOGGXGTVJG[JKV
Number One in their native
country’s charts, as well as advancing to academy
and arena tours worldwide. They performed
to some 14,000 fans across four shows in the
UK last year, bringing with them an upsidedown rotating drum kit and enough heat to
accelerate the arrival of summer. They outgrew
VJGEQPƂPGUQHVJGKTOGVCNEQTGTQQVUYKVJGCUG
EQPƂFGPVN[UVTKFKPIVQYCTFUCPGYKFGPVKV[PQV
simply “chucking in breakdowns, or just ripping
QWVCUQNQqHQTVJGUCMGQHVJGKTUQWPF+VYCU
Winston points out today, “a time of having
done something for such a long period of time,
and then trying to reinvent yourself within the
parameters of what you love”.
Away from the success of their career
evolution, however, Parkway Drive were being
ruthlessly beaten down by personal tragedies
and harsh global realities.
“We went through this process of an
incredible challenge of creating a record,
followed by us playing that record,” remembers
VJG[GCTQNFp+VYCUKPUCPGN[YGNNTGEGKXGF
DWVCVVJGUCOGRQKPVKPVKOGKVYCUVJGƂTUV
divisive thing we’ve ever created, so there was
whatever side of that response being levelled
at us. And, while all that’s happening, there was
GXGT[VJKPIGNUGIQKPIQPDGJKPFVJGUEGPGU+V
was very hard to just exist, put it that way.”
+VYCU UQOGVJKPIQHCPKPGXKVCDKNKV[VJGP
that the toughest challenges Parkway Drive
have ever faced would manifest themselves in
new album Reverence. A stunning soundscape
of emotional agony, frustration, hopelessness
and what Winston describes as a “very dark
URKTCNNKPIRTQEGUUq+TGoUHQNNQYWRVCMGUKP
unimaginable misery and spits back with a
healthy serving of bile; lead single Wishing
Wells’ eye-opening lyrics of, ‘So ask me how
I’m coping, and I’ll smile and tell you: “I’m
LWUVƂPGq9JKNGFQYPKPUKFG+oOUETGCOKPI
’til I fucking bleed,’ serve as something of an
indication of their turmoil.
Understandably, Winston is still feeling raw.
Some wounds never heal, and he’s learnt that
the hard way. But, over the course of Kerrang!’s
80-minute interview with one of metal’s
most endearing leaders, he opens up in an
with rehabilitation after losing his right leg in
the collision.
“We were completely shattered by that,”
Winston whispers, as he talks K! through a
UGTKGUQHETWUJKPICHƃKEVKQPU
Already feeling shaken by his friends’ ordeal,
he pauses to compose himself and recount
what happened next. Just two weeks later, while
the band were still on the road, a loved one
back home in Australia, very close to one of his
bandmates in Parkway Drive, had been given
the worst possible news: they had cancer.
p+YCMGWRKPCDWUCPFQPGQHVJGOGODGTU
has left,” Winston says in disbelief. “And we’re
just like, ‘What the fuck is going on?’’’
After slowly letting the news sink in and
telling his heartbroken friend, “Whatever you
need to do, go and do it,” yet another blow
was struck: several weeks later, the vocalist’s
ƂXG[GCTQNFFQI/QPV[YCUCNUQFKCIPQUGF
with a form of the disease – and it was instantly
known to be terminal. “They were like, ‘He’s got
two months to live.’ Two
weeks later, he died,”
Away from the Aussie sun,
Winston exhales, taking
Parkway found new ways
time to pause and pick
of easily maintaining a tan
out the right words.
p+JCXGCXGT[UOCNNe
like… my family is my
wife, my cat, and my dog.
So that was completely,
LWUVETWUJKPI/[YKHG
used to call him my
shadow, because she
would go out to work,
and it was me and him in
VJGJQWUG/[ECVYQWNF
be asleep all day, but
he’d walk around behind
GXGT[YJGTG+YCNMGFCPF
+oFLWUVVCNMVQJKO*GYCU
my little shadow. He died
in my arms.”
Yet again, Winston was
afforded very little time to
grieve: just a few months
HQNNQYKPI/QPV[oUFGCVJ
after a bravely-fought
three-year battle with
cancer, Architects guitarist
Tom Searle lost his life at
the age of just 28.
“Earth-shattering” is
incredibly moving way to give context to what
Winston’s initial description of Tom’s passing,
is undoubtedly the band’s bleakest album to
which not only left a hole in Parkway Drive’s
date. He doesn’t want this story “to be a focal
lives – the bands are very close friends – but
point for people to come and talk to us about
rock and metal as a whole. Having known
it”. Similarly – and even more crucially – he
about Tom’s illness since very early on in the
absolutely does not want “to drag someone
diagnosis, Winston recalls hanging out with him
into the limelight because of loss”. But he has
while the two were on tour in Europe together,
bravely prepared himself to explain why the past with the guitarist having to return home to the
three years have been, as he puts it, the worst of
7-VQTGEGKXGVTGCVOGPVp+CNYC[UVJQWIJVJG
Parkway Drive’s lives…
was going to beat it. You never think it’s going
to…” Winston pauses, “go that way.”
t all began in late 2015. Less than two
Six days passed. The pain of losing Tom was
OQPVJUCHVGTVJGTGNGCUGQH+TG2CTMYC[
still overwhelmingly fresh, when Parkway Drive
Drive were enjoying a headline tour in
found themselves at Reading Festival, having
America – Ohio, to be precise – when
just played a storming eight-song set on the
they received the news that their friends in Los
main stage to thousands of fans. And then…
#PIGNGUJCTFEQTGETGY6JG)JQUV+PUKFGJCF
another tragedy. The band’s loved one sadly
been in a horrifying bus crash in El Paso, Texas.
lost their battle with cancer.
Their former tourmates’ vehicle had collided
“That’s why we pulled out of Leeds – we just
with an 18-wheeler truck, killing both drivers
couldn’t… couldn’t… we just couldn’t,” Winston
and critically injuring members of the band
UVWODNGUVT[KPIVQƂPFCOGCPUVQGZRTGUU
and crew. Even to this day, frontman Jonathan
himself. “And that whole time we were playing
Vigil is learning to walk again, guitarist Zach
gigs and people were saying, ‘Hey, how are
Johnson has undergone 12 gruelling surgeries,
you doing? What’s going on?’ and you’re just
and drummer Andrew Tkaczyk is still dealing
like, ‘Yeah, nothing! We’re doing great, this is
I
“WHEN DID LIVING
IN MOURNING AND
IN GRIEF BECOME
NORMAL?”
W I N S T O N
M
C
C A L L
Winston McCall, London,
March 2018
KERRANG! 27
THIS IS THE SOUND OF VIOLENCE
WINSTON MCCALL ranks PARKWAY DRIVE’s life’s work…
1
REVERENCE ( 2 0 1 8 )
“Anything
we do as a
band, it’s a reflection
of us, and you’re
obviously going to
feel more attached
to the most recent
thing. But that being
said, I’m so proud
of what we’ve been
able to create with
this record, on every
single level. If we
28 KERRANG!
never do anything
ever again, I’ll
be proud that we
managed to achieve
this. That’s quite
simply it – in every
single
g aspect!”
p
2
IRE ( 2 0 1 5 )
“I know
what it
took for us to create
that record, and
the entire process
of reinventing
ourselves, and what
that record gave
back to us. And
on top of that, I
fucking love all of
the songs on it.
I can remember
every single song on
that record, because
it’s memorable. At
the end of the day, if
my mind’s hanging
on to it, it’s a good
song ( laughs).”
3
HORIZONS ( 2 0 0 7 )
“Before
we did the
[album anniversary]
shows in Australia,
there was so much
of Horizons that I
couldn’t remember.
But now that we’ve
played them, I’ve
understood them
again. I think, for the
different periods of
what Parkway Drive
is, as far as superfast, super-heavy
and super-technical,
Horizons is when we
peaked. And I like
that. It’s short, concise
and intense.”
Winston would
come to regret his
stagediving open-invite
were fuel for the music, rather than the other
awesome…’ But it’s like, when did tragedy and
way around, as the band have worked in the
living in mourning and in grief become normal?
RCUVsOCMGCNDWOPWODGTUKZJKUƂPGUVJQWT
To the point where people are asking you
normal questions, and you’re replying, ‘Yeah, I’m From the aggressive sarcasm of Prey’s ‘We
are all prey for the sorrow’ chorus, through to
okay.’ And the reality of it was that we weren’t.
a regretful, ‘You never know the words you
“When you lose incredibly young, healthy
should have said / Until they’re all you’re left
friends to a disease, which shouldn’t by any
with,’ in beautiful closing track The Colour Of
UEKGPVKƂEOGCPUGXGPEQOGKPVQVJGGSWCVKQP
Leaving, Winston paints a graphic picture of
of their lives, and yet all of a sudden they’re one
his emotional journey. Not that it’s helped him
from the person you knew from six months ago,
ƂPFRGCEGYJCVUQGXGTp+VoUDGGPCEQRKPI
to no longer being around you, you just go,
mechanism, I think… but it’s not a healing
‘Give me a fucking reason. Give me something,
thing,” he admits. “There have been things that
because no dots connect here to make sense of
I’ve written about in the past and people are
this outcome.’ It just seems fucking cruel. You’re
like, ‘That must have felt cathartic to write?’ and
just left with a gnawing fucking emptiness where
I’m like, ‘Yeah, it kinda did.’ But for this stuff, it’s
that person used to be.”
not. Lyrics came out simply because that’s all I
Away from the shock of hearing each
could think about at that point in time.”
event told, it is, genuinely, hard to listen to
Reverence also shines a light on a side of
Winston – a brilliantly booming circle-pitWinston rarely seen before: Shadow Boxing
inciting voice onstage; an infectiously warm
openly illustrates the vocalist struggling with
soul offstage – speak like this. To hear of how
the realisation that, ‘+ƂPFVJKUOCUM+YGCT
Parkway’s somewhat reductive ‘good-time band’
can’t keep the
reputation made the
darkness in.’
situation even harder
Do you really feel
to withstand. Of the
like you’ve been
nature of living in
wearing a mask at
“survival mode” simply
certain points over
to get through the day.
these past years?
Of how they returned
“Oh yeah, of
home from tours to
course,” he chuckles,
attend funerals.
easing the tension.
“It’s just been
W I N S T O N M CC A L L
“And it’s been
brutal,” the vocalist
forced upon you,
sighs. “It’s been
to a certain degree.
completely and utterly
I’m a happy person, and I live in an amazing
brutal for three years. And it’s not like the whole
place, and I play in a band that I love, and I get
time we’re walking around depressed, and the
to do fucking awesome things, but, that being
whole time standing onstage not meaning the
said, to be able to exist without succumbing to
smile that I have on my face. It’s just… there have
basic instincts to just lash out at something is a
been so many times where I’ve been beaten so
challenge. It’s been walking on a snapping point
hard with this feeling that I don’t know if I can get
back up. But when I do drag myself back up, in a
for quite a long time. I think people take it for
couple of months, I get smashed down again. It’s
granted that I am ‘the nice guy’ that will smile
been… really fucking challenging.”
and take this shit, basically (laughs).”
Were there moments you thought about
While also traversing this troubled state of
putting the band on hold to cope with it all?
affairs, Winston found himself incensed at the
“Yeah. There was. But what can you do?”
wider world as he worked on the lines that
Winston replies. “Some of these things were
would make up Reverence. And these issues
people that had been diagnosed a long time
– the rise of racism and xenophobia, issues
CIQCPFKVƂPCNN[JCRRGPGFCPFUQOGQH
of paedophilia within religious institutions, to
these things were so sudden that no-one saw it
name just a couple – sit (un)easily alongside
coming. There was no pattern of being able to
Winston’s more personal moments; the furious
predict what the fuck was going to happen next.
Absolute Power declares, ‘The hate runs deep
+VYCUNKMGn1J[QWoTGƂPCNN[QWVQHVJGYQQFU
but our hopes cut deeper,’ while I Hope You
on this one? Nah, we’re dragging you back in.’”
Rot concedes, ‘To prey upon the weakest lamb /
The cruellest heart is truly man.’
s is the way it often goes, out of
“It seemed like anything I was commenting
insurmountable tragedy comes
on, on a broader scale, was something to
great art. And in Winston McCall’s
do with a power-play of some description,”
case, the words he’s penned across
Winston nods when we enquire about the
Reverence’s 10 tracks – the majority of which
record’s many religious references tying in with
“THERE HAVE BEEN
TIMES I DIDN’T KNOW IF
I COULD GET BACK UP”
A
4
DEEP BLUE ( 2 0 1 0 )
“I love
Deep Blue.
It was the first time
we started stepping
away from our
roots. At the time we
recorded it, everyone
else was going for
the metalcore that
exploded, and they
were going for supertight production,
and that digital
production, and that
was the first time
we went, ‘Nah, fuck
that, we wanna go
over here.’ I love it,
because it’s the road
less taken.”
5
KILLING WITH A SMILE ( 2 0 0 5 )
“It’s
not that
I dislike Killing
With A Smile, but
it’s the least maturesounding Parkway
Drive record. I hardly
resonate with any
of those lyrics any
more, and when
I listen to the record
I can hear the
immaturity in the
songwriting and the
lyricism. I love the
energy of it, but it
feels rougher than
I’d like. I’m all for
rawness, but I also
appreciate thought!”
6
ATLAS ( 2 0 1 2 )
“Again,
I still love
that record, and it
gave us fuckin’ Wild
Eyes and Dark Days –
there are still bangers
on that record! But I
think this was the first
time when we really
started trying to
push away, and Atlas
should have maybe
gone where Ire ended
up, but we were too
afraid to actually
go that far. That’s
the only reason [for
ranking this album
last] – I can hear
potential unfulfilled.”
KE ANG!
KERR
G 29
tthese themes. “I’m happyy with the person that
I am and myy beliefs – and myy beliefs are simply:
y
w are tinyy beings,
we
g and our comprehension
p
power
is limited in a veryy large
g universe. To sayy
t
that
someone’s belief in something
g all-powerful
d
doesn’t
exist is just
j as ignorant
g
as forcing
g that
be e o
belief
on so
someone
eo e e
else.
se The
e references
e e e ces – the
t e
c
concept
of God or the Devil or anything of that
n
nature
– are, I think, put in there to give that
impression
i p
of the smallness of us, and the sense
of
o there being forces beyond our control.”
tthe title being
g that of the skyy while the singer
g
was digging
gg g his dog’s
g grave),
g
it’s a song
g veryy
m
much
focused on the actual moment of saying
g
goodbye
y to someone you
y cared about. You can
h
hear
Winston’s voice shaking
g on its last few lines.
I was, he remembers, “the hardest thing
It
g
I ever had to perform.
I’ve
p
I still can’t listen to
t
that
song and not get choked up by it, that it’s
f
fuckin’
me singing it, which is insane. The lyrics
were
e e so hard
a d for me, that I didn’t sing them until
when it came time to record, because I literally
couldn’t
c
get them out. It was just like, ‘Let’s do
h
here
are two veryy different sides to
some
s
takes, and the one where you don’t end
o interview with Winston today. As
our
up
u fucking
g crying
y g uncontrollablyy is the one that
anyone
a
who’s met or spoken to the
we’ll
e use o
on tthe
e record.’”
eco d
frontman
f
before can attest, he is very
Are you ever going to play it live?
much
m
a dream conversationalist: charming,
“I
“ don’t know…” Winston ponders.
p
“I’ve
chatty,
c
open and very funny. When the focus is
thought
t
of never playing it, and I’ve thought of
on
o the harrowing heartache that has consumed
really
r
wanting to play it. The technicality of how
his
h personal life, the jokes naturally stop and
hard
h
that was in the studio,, could I ever do it
the
t interview takes a very serious tone. Quiz
again?
a
We’ll see if it ever happens, but if it does
him
h on the music and the creative p
process of
then
t
it’s going to be done for a reason.”
Reverence,
R
though, and Winston positively
It
I remains to be seen, too, how Parkway Drive
lights up. He enthuses about the “distilling
will unveil their most powerful songs
g yyet in a live
process”
p
of Parkwayy Drive’s meticulous writing
g
environment.
e
After a series of low-keyy shows
approach.
a
He loves that they’re not a band
last month – where only Wishing Wells and
who go,
g “Oh, we went awayy and bought
g a
second
s
single The Void were aired – Winston
cabin
is
cab in the
t e woods
oods
i nothing
g short of
and
and
thrilled
a d we
e sat there
t eea
d
t ed at how
o tthiss
did
album
has alreadyy
d d whatever!”
ate e He
e
a
praises
guitarist
Jeff’s
proved
to be a “circuitp
g
p
commitment
breaker”
band.
co
t e t and
a d work
o
b ea e for
o the
t e ba
d
ethic and how,
ethic,
how when
It’ss been “starting
It
starting at
they’re
ground
zero, and then
t y in his studio,
g
b l
the
building
it up”,
t six-stringer
g will
m
i opportunities
ii
keep
hammering
meaning
k
g awayy
i the
t e Reverence
e e e ce era
ea
at
in
a his instrument long
g
aee
dless
after
are
endless.
a te the
t e band
ba d have
a e
F now,, this
packed
up
For
p
p work for
s
l
the
stretches
to headlining
t day.
y “Jeff’s one of
W I N S T O N M CC A L L
Do loads seco
d
my favourite guitarists
Download’s
second
g
s
and
stage
in June, as wellll
a I’m fucking
g stoked
cou tless other
ot e
that
I get
as countless
t
g to write
f
music
with the dude,” Winston grins.
“He
festivals
in Europe throughout the summer.
m
g
A beyond that, full arena tours will surely
has
And
h this abilityy to write these fantastical soaring
g
f
lead parts,
but then also write these twistedfollow.
And you can bet your bottom dollar that
p
P
fuckin’-strange
Parkway
Drive will be savouring every single
f
g sounds.”
m
From a creative standpoint,
in fact,
moment,
enjoying Donington Park’s sunset,
p
a each and every passing day on the road
Reverence was a joy
and
j y to make. While Ire saw
t year. It’s a positive outlook that only comes
Parkwayy Drive excitedlyy dipping
this
g their toes in
w
new
when
life has thrown its worst at you.
n waters, their sixth full-length
g is the sound
“ made me realise
l how much I love
l
of
“It
my
o a band ignoring
g
g the ‘no diving’
g signs
g and
f
cannonballing
friends
and the people in my band, and what
c
g straight
g in at the deep end. “I
FQPoVTGOGODGTCURGEKƂERQKPVYJGTGYGUCKF
I would do for those people, and how they are
F
R
R
f
goes,’” Winston says.
family,”
Winston smiles as our conversation
‘‘Okay,
y anything
y
gg
y “But that
F
was the wayy we were doing
anything FTCYUVQCENQUGƂPFKPICOQOGPVQHTGURKVGKP
w
g it – literallyy a
a otherwise emotionally
ll draining discussion.
goes. There’s no such thing
an
g
g as holding
g on to an
“ e e have
a e been
bee times
t es where
e e we’ve
e e bee
old concept of what we have to be, simplyy for
“There
been in
o
s
situations
which we never thought we’d be in,
tthe sake of it having
g to be there. That meant
C
CPF[QWƂPFQWVYJQRWNNUVJTQWIJDCUKECNN[
tthat a lot of the bits that were at the edge
g of
last time are now where a lot of
When you’re in a bus with a very llimited amount
tthe spectrum
p
o people
p p on the other side of the world, and all
within this record.”
of
tthe time is occupied
p
Q
‘So
QHCUWFFGPGXGT[VJKPIEQNNCRUGU[QWƂPFQWV
IIt’s a far cryy from the musicians who wrote, ‘S
l
who’s holding
you up. That is something that, at
ccryy me a fucking
g river, bitch’
h’ before
be o e a havoca oc
ensuing
e
g breakdown on debut album Killing
g With least, I’ve been able to take away from it.
“
A Smile’s single
“I’m
lucky to be here. I’m lucky to do what
g Romance Is Dead. Cemeteryy
l be
Bloom
brings
I do. And I never thought that there would
B
g haunting
g backing
g vocals to create
s many faces that I can see in my mind now
atmosphere
unlike anything
so
a
y
g Parkwayy have
tackled
before; Shadow Boxing
which I’m never gonna see again. For me, that’s
t
g sees Winston
utilising the softer tones behind his usual
what the album title is: it
it’ss realising how special
ti e is, that every second you get, that’s allll
ear-splitting
e
g roar; and Chronos culminates
time
y have, that’s your currency in life. And I’ve
in
i the most stirring
g string
g segment
g
ever heard
you
s got it, and it’s fucking awesome.
a eso e. And
d that
t at
in
i the band’s discography.
g
y
still
m
And then there’s The Colour Of Leaving.
g Half
makes
me happy.”
written for Tom Searle (featuring
g the lyrics:
y
‘You
ou
REVERENCE IS RELEASED ON MAY 4 VIA
don’t
d ’ know what you’ve
y ’ got
g / Until it’s
’ gone
g
EPITAPH. PARKWAY DRIVE PLAY DOWNLOAD
with
t the
t e wind’)
d
d’) and half written after Winston
FESTIVAL IN JUNE – SEE THE GIG GUIDE
buried
b
his beloved Montyy (with the ‘colour’ in
T
“I’VE REALISED
S HOW
O
MUCH I LOVE MY BAND
BAND,,
MY FRIENDS,, AND WHAT
I’D DO FOR THEM”
30 KERRANG!
G
PWD: (clockwise from bottom left)
Luke Kilpatrick, Ben Gordon, Jia
O’Connor, Jeff Ling, Winston McCall
THE ART
OF HURT
WINSTON
delves into
REVERENCE’s
album sleeve
“It’s an actual
painting – it’s a
piece by Peter
Paul Rubens, who’s
a Belgian artist. And
it’s called The Fall Of The
Damned. It’s a fucking
insane piece, and we
just tweaked it around.
As soon as we saw the
reference image online,
we were like, ‘Fuck!
That’s it!’ That’s what the
album is, 100 per cent to
me. And it just happened
to be something that we
could use, and our art
director could work with
as well. The work that
he’s actually done on it
is fucking insane. Being
able to somehow add the
writing and the logo into
the actual painting itself,
so it looks like it’s actually
supposed to be there, is
pretty fucking wild. The
more you look at it, the
more it’s like a fucking
Where’s Waldo painting
of pain (laughs).”
KEERRAANG! 31
3
S H O T S !
SKUNK ANANSIE
Skin
Photo: getty
Photo: getty
Photo: GETTY
HAYLEY WILLIAMS
PARAMORE
S H O T S !
S H O T S !
Photo: PEROU
AMY LEE
EVANESCENCE
S H O T S !
HOLE
COURTNEY LOVE
Photo: getty
Photo: getty
Photo: ANDREW LIPOvSKY
TAYLOR MOMSEN
the PRETTY RECKLESS
S H O T S !
THE K!
K! INTERVIEW
D O
I
E V E R
T H I N K ,
‘What if I’d joined
NIRVANA?’
Y E A H ,
I
C O U L D
B E
DEAD TOO
J M SC S
Words: Paul Travers
W
NOSAU
PHOTOs: Andy Ford, GETTY
ith his long straight
white hair and beard,
J Mascis looks like a
slacker Saruman. Which
is pretty apt, too,
because he’s a fretboard wizard, whose
howling, distortion-drenched solos
have been lighting up the ears of the
discerning for more than three decades.
He’s the six-stringer that Kurt Cobain
wanted in Nirvana and the melodymeets-volume approach of his main band
Ã>ÕÀÀ°Ü>Ã>Õ}iyÕiVi
both grunge and the wider alternative
rock scene. Coming from a hardcore
background, J set his sights on playing
‘ear bleeding country’ with Dinosaur (the
‘Jr.’ was added later after a legal tussle).
This soon evolved into a signature sound
mixing simple song structures and drawled
vocals delivered with crushing volume,
jagged feedback and those instantly
recognisable leads.
When Dinosaur Jr. fell apart in the
late ‘90s, J continued to make music in a
succession of largely solo projects, doom
metal side bands and collaborations. The
38 KERRANG!
classic Dinosaur Jr. line-up also reformed
in 2005 and has been churning out that
beautifully tempered noise ever since. For
the supposed king of the slackers, he’s
LiiÃÕÀ«ÀÃ}
Þ«À
wV]LÕÌv>}
ÕÃVÃÌ
wÀiÃÕ«]Ì>
}>LÕÌÌi
process really doesn’t.
Ã>v>ÕÃ
Þ`vwVÕ
ÌÌiÀÛiÜii°
He’s not aggressive or unfriendly as such,
just… uncommunicative. He chuckles
repeatedly throughout our long, careerë>}V>Ìq>«>ÀÌvÀi y>Ã}
moment, when he gets visibly pissed off
– but rarely offers more information than
is strictly necessarily. And sometimes even
less than that.
One thing to adjust to is the barely
audible level at which he speaks, especially
given the soundcheck going on in the
>`>ViÌÀ>Ì-ivwi
`½Ã*
Õ}]ÜiÀi
Dinosaur Jr. are due to play tonight. He
also talks with glacial slowness. There are
ÌiÃÜiÞÕÌi½ÃwÃi`>`>Ài
Ìi«Ìi`ÌwÀivvÌiiÝÌμÕiÃÌÌ
keep whatever sense of momentum there
might be going. If you leave him the space
he will sometimes say more, but just as
JR.
J Mascis, shot
for Kerrang!,
Sheffield, April 2018
KERRANG! 39
J Mascis, not so
enthused about being
shot for Kerrang!
DINOSAUR
WHO-NIOR?
Everything you
need to know
about the iconic
alt.rock veteran
BORN: December
10 1965, in Amherst,
Massachusetts.
LIVES: Still in Amherst,
Massachusetts.
EDUCATION:
The University
of Massachusetts
Amherst. Fellow
alumni include actor
Richard Gere and
Pixies guitarist
Joey Santiago.
BANDS: Deep
Wound, Dinosaur Jr,
J Mascis + The Fog,
Witch, Upsidedown
Cross, Sweet Apple,
Heavy Blanket.
SPECIAL SKILLS:
Extreme volume
onstage. Extreme
quietness off it.
MOST LIKELY TO
SAY: “Yes, no, uh-huh.”
LEAST LIKELY TO
SAY: “Let’s have a
lively debate.”
HE’S A LEGEND
BECAUSE: Give him a
guitar and listen to him
wail. Also, he turned
down Nirvana.
3 KERRANG!
often you’ll realise that nope, that was it, as
you sit in awkward silence. This’ll be fun…
What’s the first music you remember getting
excited about?
“Oh (yawns). Maybe, like, The Beach Boys.”
What was your introduction to the hardcore
punk scene?
“I got into hardcore just through listening to
RWPMKVUGNH+IQVKPVQ'PINKUJRWPMƂTUVCPF
then I started discovering, I guess, the third
generation of English punk that was going on
with Blitz and the U.K. Subs. Then I discovered
hardcore was happening around America
through fanzines and stuff.”
And you were still in high school when you
started your hardcore band Deep Wound?
“Yeah.”
What was the appeal? Why did you
decide to dive into the scene yourself?
“It’s just where I was at. That’s what
spoke to me at the time, but there
weren’t many people around who
were into it. I met my bass player
VJGTGCPFVJGPGZVYGGM+UCYCƃ[GT
for [musicians that liked] Anti-Pasti,
that said they needed a drummer. It
was a bit problematic because none
of us were old enough to drive, so our
parents drove us around.”
not good at playing rock songs. I never tried
VQƂIWTGQWVCP[UQPIUD[GCTYJKEJ+FKFFQ
on drums. When I started guitar it was for the
band and to write songs. I never really had the
time or that mindset of trying to learn Stairway
To Heaven. I was off on my own already.”
So it was all about channelling what you
had inside?
“Yeah, and writing songs for a band. I had
limited ability, so it was whatever I could play,
which would also be what I would write.”
And the distortion and feedback became part
of that signature sound?
“Yeah. I was coming from drums and when
I started guitar it seemed very wimpy by
comparison – very un-dynamic. Volume and
effects were to try to emulate the feeling
I would get from the drums. They just allowed
me to be more expressive.”
Were all those different directions a reaction to
the narrowness of hardcore?
“It just seemed like hardcore was over and
it was time to move on. Negative Approach
turns into the Laughing Hyenas and Minor
Threat turns into Fugazi. It seemed like a
natural ending of one thing and a moving on.”
You always crop up in top guitarist lists. Does
that mean anything to you?
“Yeah, sure, it’s cool.”
Most bands are all about their latest album. Do
you think you’ve ever topped You’re Living All
Over Me?
“It’s the best one, I think. A lot of times for you
the new one is the more enjoyable, simply
because it’s new. It doesn’t mean it’s the best
one, but it’s the one you like the most at the
time because it’s the one you’ve been doing.”
You once named your big breakthrough, Bug,
as your least favourite album. What don’t you
like about it?
“I just don’t like the feeling behind it. It was a
bad time.”
The tensions between you and Lou?
“Yeah, that. And it was a bit rushed.
We had to rush to get it out, and we
J in a much more
didn’t quite have enough songs. But
comfortable setting
yeah, the band vibe was really bad.”
Was it a difficult thing to go through
when the band was your life?
“Yeah. We just knew it was time for a
change. Lou didn’t want to quit the
band, but I think he wanted it to end.
He was kinda undermining it and
that’s a weird feeling too – wanting it
to be over, but not wanting to quit.”
What prompted the switch from
drums to guitar for Dinosaur?
“Hardcore just seemed to peter out.
It seemed to be over. I still wanted to
FQOWUKE+YCULWUVVT[KPIVQƂIWTG
out what to do and I thought I should
play guitar and write songs. Because
I didn’t like any guitarists around,
DWV+ƂIWTGF+EQWNFUJQYUQOGDQF[
how to play drums. So I switched to
guitar and put Lou (Barlow) on bass
from guitar. Initially we had the singer
from Deep Wound as well (Charlie
Nakajima). We were called Mogo, but
after one gig it didn’t seem like it was
going to work out, so we broke up
and reformed as Dinosaur, basically
kicking out the singer.”
It sounds like a relationship that had
gone sour…
“Yeah, exactly.”
Post-Nevermind, even bands like
Melvins were getting signed to
major labels. Did you get swept
up in that frenzy?
“Yeah, it was a lot different after
Nirvana, for sure. It was more like,
‘Oh, you’re selling a certain amount
of albums? You might be better
off on a major because they’ll have
better distribution and then you’ll get
enough money to make the thing.’
Indie labels were notorious for not
paying. Everyone says that major
labels rip you off. Maybe that started
coming afterwards when everyone was
glorifying indie labels, but indie labels
were all crooks, in my experience. It
was a lot more straightforward on a
major. They’d just give you the money to make
the record and the videos.”
getty
You’ve described the debut album as
‘ear-bleeding country’, but it actually
went in a lot of different directions…
“That ‘ear-bleeding country’ thing
was just an initial band concept: ‘We have a
band and this is what it will be about.’ We were
just trying different things.”
we wanted to be on SST (Black Flag guitarist
Greg Ginn’s label), that was our big goal. So
it all happens and then it all kind of falls apart
after that.”
Is it true that your first album [1985’s
self-titled] was recorded for roughly $500
in a home studio in the woods?
“Yeah.”
How do you think it stands up?
“It’s okay (laughs). It’s… whatever. We didn’t
really have a sound. Every song sounded a
NKVVNGFKHHGTGPVCPFYGYGTGLWUVVT[KPIVQƂIWTG
it out. That was another thing… we knew we
could put out a record as soon as we formed.
$CUKECNN[YGVTKGFVQFQQWTTGEQTFƂTUV+VoUPQV
NKMGYGRNC[GFCTQWPFCNQVƂTUVq
Do you consider yourself a guitar great?
“No (laughs).”
And your second album, 1987’s You’re Living
All Over Me, is often held up as a classic…
“Basically we achieved everything we set out
to do with that record. After that it’s weird.”
Well, do you at least consider yourself a
distinctive guitarist?
p;GCJ+FGƂPKVGN[JCXGUQOGUQTVQHUV[NG+oO
Does that mean it was all downhill from there?
“Yeah (laughs). What do you do after that?
You’re still alive. Yeah, it’s strange. Because
Did they ever try to coerce the band into
changing anything?
“No. Well, not until the last thing, when we got
dropped and I heard that famous cliché that
I always thought was a joke. You’ve got the guy
listening to the album and going, ‘I don’t hear
a single on there.’ It was such a joke thing to
say that you know that it’s the end.”
Kurt Cobain asked you to be in Nirvana once.
How did that come about?
“It was at Maxwell’s – this club in Hoboken,
New Jersey. It’s a small place, but a lot of
bands played there for their New York kinda
show. I’d hang out there and Nirvana played
there. They had another guitarist at that
time, the guy who was in Soundgarden after
that [Jason Everman]. I don’t think they were
getting along. I think he [Kurt] was sick of the
KERRANG! 41
guy and he just said to me, ‘Hey, you should
be in Nirvana.’ I didn’t think about it really at
the time. At the time we were bigger than they
were and I was doing my own thing.”
Do you ever look back and think, ‘What if…’?
“Do I ever think, ‘What if I joined Nirvana?’
Yeah, I could be dead too.”
Is there any part of you that would have liked
that level of fame and commercial success?
“It’s strange, I never really thought of that. It
wasn’t on anybody’s mind when you’ve come
from a hardcore band. It’s hard to say how
something would have affected you, but I do
know that the more successful I was, the more
unhappy I became. Maybe that really would
have pushed me over the edge.”
How was the secret show you played with
the remaining members of Nirvana when
they were inducted into the Rock And Roll
Hall Of Fame?
“Oh yeah, that was fun. That was crazy. I saw
so many people from the past that I hadn’t
seen in many years. They had bodyguards and
everything. It was very strange. I was also at
the Nirvana Unplugged show. That was the last
time I saw Kurt alive, in fact.”
You’re often credited with influencing grunge
and alternative rock. Do you recognise that
when you listen to stuff?
“I don’t hear it.
Occasionally I’ll hear
something, but only if
someone tells me.”
Okay. There’s a perception that
you were in control, but why did
you decide to disband Dinosaur
Jr. at that time?
“I dunno, it just felt like time.”
How different was it working on
J Mascis + The Fog?
“A lot of people think it sounds
the same, but I didn’t have to
think about, ‘Can [Dinosaur Jr.
drummer] Murph play this beat?’
or any restrictions. It was more
open-ended, in that I could do
whatever I wanted musically.
But it was just me singing and
playing guitar, so it sounds like
Dinosaur to a lot of people.”
Dinosaur Jr.:
far from extinct
Your More Light album referenced the Hindu
spiritual leader Amma. Could you briefly
explain who she is?
“They call her The Hugging Saint. She tours
the world and people go up to her, wait in line
and get a hug. She does a lot of charitable
things in India: she has free hospitals and free
housing for the poor. In India she does more
for poor people than the government.”
What impact did she have on your life?
p#NQV+LWUVe
long pause). I felt better.”
“INDIE LABELS
WERE ALL
CROOKS, IN MY
EXPERIENCE”
Does spirituality help you
deal with your depression
and mental health?
“Yeah, for sure. By just
being aware and thinking
about other people, rather
than your own situation.”
Fun fact: J has never
returned a library
book a minute late
Who’s told you they
were a fan that made
Does music help you work
you go, ‘Oh…’?
through things as well? Is
“There’s a guy called
it a cathartic process?
John Grant who had
“Of course, but not happy
Budgie from Siouxsie
music. Only depressing
And The Banshees and
J M A S C I S
OWUKE
laughs).”
Big In Japan playing
drums for him. I was
When did you know it
really excited to meet
was the right time to get back with Lou and
him and he said he liked my singing, which was
Murph and bring back Dinosaur Jr.?
strange. Not a lot of people say that. I hear
“It just felt right. Lou was angry for a long
guitar playing or the band or the songs a lot,
time. We had to wait for his anger to die down
but not the vocals.”
laughs). He apologised to me. I’d go see his
bands – or try to – but he never came to see
A lot of musicians do cite Dinosaur Jr. as
me. He had a lot to work through. We had to
an influence…
wait until he’d mellowed out.”
p$WVPQVURGEKƂECNN[O[UKPIKPI
laughs).”
Do you feel like an icon?
“I would have to take that with a pinch of salt.”
Is it gratifying if a band you think are cool
says you are an influence?
“Yeah. It’s great.”
One U.S. magazine had the words, ‘J Mascis is
God’ on the cover. Was that a bit much?
“It’s always like that, though. Whenever there’s
something good, like appearing on the cover
of a magazine, there’s something bad, like the
fact that they made it embarrassing. Nothing is
ever all good, there’s always a bad side.”
Why did you decide it was time to retire the
Dinosaur Jr. name in ’97?
“Why do you say, ‘Retire the name’? Man,
I hate when people say that. That’s really
demeaning to the guys that were in the band
at the time, I think. Like, it’s not a band. To
them and me at the time, though, it was a
DCPF+ƂPFVJCVFGRTGUUKPIq
42 KERRANG!
Do you have a better relationship now?
p
Long pause) It’s better than it was when
things were falling apart.”
The early years: which
explains the black
and white photo
Are you excited when you make music and
tour, or is it just what you do at this point?
“Both. I like touring more now than I used to.
I didn’t enjoy it very much at all in the old days.
I enjoy playing now. I appreciate it a lot more.”
You’ve been labelled as a ‘slacker’ throughout
your career, but you’ve been pretty prolific
down the years. Are you actually quite driven
in reality?
p;GCJ+UWRRQUG-GXKP5JKGNFU
/[$NQQF[
Valentine) said it’s just because I talk slow.
That’s the image I have, but I have done a lot
of stuff. You can’t be as lazy as people think
I am and achieve anything.” K!
DINOSAUR JR.’s latest album GIVE A
GLIMPSE OF WHAT YER NOT is out now
ON JAGJAGUWAR
The latter years: Or
Dinosaur Snr., if you will
As you can see, Lemmy was always a man of taste. Back
in 1982, he modelled one of the first-ever Kerrang! T-shirts.
Now we’ve reprinted this klassic shirt along with two others,
celebrating the three stages of the world’s greatest rock brand.
Screen-printed on high-quality shirts, each ‘T’ costs £15 (UK)
or £18 (overseas). Grab the shirt of your choice via
Newsstand.co.uk/kerrang
All prices include postage and packing. Please allow 30 days for delivery,
as each shirt is printed to a rather high standard. We thank you in advance.
THE INSIDE TRACK
S PA R K S
AND
RECREATION
It had been ages since we last heard from
CANCER BATS – then suddenly they dropped a
surprise new album on us last week. As it turns out,
they weren’t just sitting around doing nothing…
Words: Simon Young
O
PhotoS: VIKTOR RADICS
n July 23, 2016,
%CPEGT$CVUƂPKUJGF
VJGƂPCN UJQYQH
VJGKT 5GCTEJKPI(QT
<GTQVQWT KP6TQOUÔ
6JGPGZVFC[.KCO
%QTOKGTIQVQPC
*CTNG[&CXKFUQP
QPNQCPHTQO VJGEQORCP[CPFUVCTVGF
VGCTKPICTQWPF0QTYC[(QT VJGƂTUV VKOG
KPRGTJCRU CFGECFGQT UQVJGDCPFoUFKCT[
YCUEQORNGVGN[ DNCPM+V YCUPoVFQYPVQ
C NCEMQH HQTYCTFRNCPPKPIVJGSWCTVGV
KPVGPFGFVQVCMGCPGZVGPFGFDTGCM CPF
JCFUSWKTTGNNGFCYC[ CP[ OQPG[ VJCV
VJG[oFOCFGQPVJGKT JGCFNKPGVQWTU
6JG[EQWNFFQITQYPWR VJKPIU NKMGRC[
VJGKT DKNNU CPFPQV CPZKQWUN[EJGEM VJGKT
DCPM DCNCPEGKH VJG[ YCPVGFVQDW[
CEQHHGGCPFC DCIGN YJGPOQQEJKPI
CTQWPF6QTQPVQ
“Everyone was looking forward to having
some downtime,” says Liam. “We were going
to take six months. I remember thinking,
¼">Þ]ÌÃÃÌ]½Ûi}ÌÌw}ÕÀiÕÌÜ>̽Ã
going on.’”
44 KERRANG!
/ÃiÃÝÌÃÌÕÀi`Ì>Þi>À>Ã
`ÀÕiÀiÞ*iÌiÀÃ>`ë>ÀÌiÀ
>i
iÜiÀi iÝ«iVÌ}ÌiÀwÀÃÌV
`]Ã
Ìi L>`q V«
iÌi`LÞ}ÕÌ>ÀÃÌ-VÌÌ
``
iÌ>`L>ÃÃÃÌ>Þi -VÜ>ÀâiÀq
ÌÀiÜÌiÃi
ÛiÃV«
iÌi
ÞÌÌiÀºÃ`i
ÕÃÌ
iû>`
Ûi`Ài
>ÌÛi
ÞÀ>
ÛiÃ>Ü>Þ
vÀÌi`i>`ÃvÌÕÀ}°
º7iii`i`ÌÀiV>À}iÕÀL>ÌÌiÀiÃ]»
>iݫ
>ðº7i
>ÌL>`Ã
i
ÛiÀ}i>` iÕÀÃð/Ãi>Àii>ÛÞ
bands who are still doing it and doing it right;
they’ve all got other things going on.
º7i``½ÌÜ>ÌÌ
Ãi«iÀëiVÌÛi]»i
>``ðºÀi iëiV>
Þ]Ü>Ã
i]¼have to
`Ìðv>`ÌÜÀÕÃÌ
>ViÀ>ÌÃ]
½`}VÀ>âÞ°ii`i`>ÌiÀVÀi>ÌÛiÕÌ
iÌ
>`ÌÌ>iÃiiÜV>
i}ið»
/ÃiÝÌi`i`LÀi>Ü>ýÌÌ
i>ÀÕ`
>`}>Ü«>Ì iÌyÝÜ
i«V}>Ì>«ââ>
from a box on their bellies. Far from it.
>vÕ`ÃVÀi>ÌÛiÕÌ
iÌÃ
ÌÀVÞV
i V
Ì}V«>Þ/Ài>`Üi
]
>``>ÀÌi`Õ«>``Ü}Ü>ÞÃ ÀÌ
>`
iÌÀ>
čiÀV>°-VÌÌÌÕÀi`Ã
>ÌÌiÌÃÌLiV}>ºÌi V>«iÀi»
The lads enjoying
another classic
Toronto springtime
KERRANG! 45
HAIL
STORM!
LIAM CORMIER
looks back at when
CANCER BATS
graced the cover of
K! in May 2008…
“I can’t believe that was
10 years ago. I remember
46 KERRANG!
you guys got to come to
some of the shows we were
playing in Canada at that
time. We played anywhere
and everywhere. At the
Fredericton show, I was
standing on a road case that
was getting kicked around
the room because there was
no stage. It was one of the
craziest shows we’ve played
in our lives.
“There was a transition
around then; something
actually changed where
people were coming in their
hundreds. We’d played some
of those same places before,
but when we came back there
were too many
people because
no-one knew what
the capacity was
for those venues.
It was sick! It was a wild idea
and electrifying vibe we
were a part of. There was a
feeling of excitement and
surprise, which I don’t think
we’ll ever have again. It was
a step up.
“Even though I was 28
when that record
came out, I didn’t
know anything.
I was basically a
goofy kid. We were really
lucky to have toured as hard
as we did. So when Hail
Destroyer came out, we felt
really confident about that
album and what we were
playing. We couldn’t wait to
crush those shows. Before
that, we were like, ‘Playing a
headline set? What is that? An
encore? Dude, we don’t even
have enough songs!’”
Carl Neumann
Liam was furious about
the rest of the band not
showing up on time
and produced bands at School House
Studios in Hamilton, Ontario. Jaye
stayed closer to home as he plied his
trade as a carpenter in Toronto and
played bass for Julie & The Wrong Guys
alongside Mikey, who had his hands
quite full as a new dad.
“It’s made us all appreciate Cancer
Bats and what we’ve built,” says Liam.
“It was never not fun, but it was good
for us to take that break. These projects
make you remember what it was like to
hustle and grind again.”
Around eight months after their set
in Tromsø, the band reconvened to play
shows as Bat Sabbath – their tribute to
some heavy band from Birmingham – in
order to make some “baby money”.
That, says the frontman, is the moment
when the Cancer Bats itch returned and they
set the plans in motion to release their new
album The Spark That Moves – their sixth – as a
surprise during this month’s four-night London
residency celebrating the 10th anniversary of
their 5K-rated second album, Hail Destroyer.
“We didn’t even have enough songs at that
point or a studio booked,” he laughs. “We just
set the date and announced the shows. I can’t
think of a better time, in my mind, to reward
our fans who’ve supported us for the past 10
[GCTU+YCPVQWTJQOKGUVQJCXGVJGƂTUVETCEM
at the record.”
6JGTGoUEWVVKPIKVƂPGCPFVJGPVJGTGoUEWVVKPI
KVƂPG9KVJCNNG[GUQPCP#RTKNTGNGCUGVJG
band relocated to Winnipeg, 1,300 miles away
from Toronto and completed the album with
producer JP Peters (Propagandhi, Comeback
Kid) at his Private Ear studio in January.
“That was the only time the studio was
free,” says Liam. “That’s where Mikey lives, and
because he’s a new dad, that [was] the easiest
thing to do. Recording outside of Toronto was
nice, because all we were doing was focusing
on this record. Winnipeg is great for that in
the dead of winter. No-one is doing anything.
We’d go to the studio, Jaye and I would work
out, Mikey would take care of his kid and Scott
would work on mixes for other bands. We did
a track a day; we’re not robots and wanted it
to sound organic, so we used a lot of the live
takes. It was rad.”
T
he Spark That Moves is the sound
of a band rejuvenated. If Liam was
concerned about going through
the motions writing straight after the
dates in support of 2015 album Searching For
Zero, his time spent on motorbikes was just
VJGƂNNKRJGPGGFGF
“Half the reason we were able to write this
record was because we all had a chance to live
and do things,” says the frontman. “If I tried to
dive in and write off the back of the last album,
I wouldn’t have had enough experience. Tons
of the songs were written off the back of what’s
happened in the past two years.”
The 11-track album, however, isn’t about
HWNƂNNKPIOGTEJCPFKUGQTFGTUHTQODKMGTU
Headwound, for example, was inspired by an
eventful motorbike ride in Baja, northwestern
Mexico in February 2017, which took the
vocalist a full year to recover from.
“When you ride on deep sand, you have to
go really fast,” explains Liam. “There are these
rolling bumps they call whoops. I was hitting
them and bouncing over, but there was a rock
in the sand and it pitched the back end of the
Honest guv, they haven’t
just been lazing around
the past few years…
bike and I wiped out. I crashed really bad and
had to ride 10 miles while holding my leg. It
was the worst and it was a year before I was
back to normal.
“That song is about how your life can
change when something like that happens,”
he adds. “It changes your perspective on
things which are out of your control. It’s such a
weird song and I’m really proud of it. I will say
that since then I’ve gone back to Baja. I did a
six-day ride and I didn’t crash. I felt vindicated!”
Bed Of Nails stems from revelations from his
epic journeys during their year off.
“Sometimes you worry that touring has
“WE’VE MADE AN
ENTIRE CAREER OUT
OF IGNORING WHAT
PEOPLE THINK”
L I A M
C O R M I E R
become our lives,” he explains. “For me,
that was a big one. That year of being off,
and riding around, I realised I was travelling
because I like it. I’m doing those trips because
I like that lifestyle and it’s not because I don’t
want to be in Toronto. I love seeing new things.
I came to a positive place with that; I’d keep
doing this even if I wasn’t in a band.”
Overall, the album bursts with the
caffeine-fuelled positivity that informed their
ƂTUVHQWTCNDWOU5GCTEJKPI(QT<GTQ%CPEGT
$CVUoƂHVJTGNGCUGYJKEJUCYVJGOYQTMYKVJ
producer Ross Robinson (Korn, At The DriveIn), was shrouded with darkness as they came
to terms with the loss of close friends.
”I love that record,” Liam says. “That album
came at such a heavy point in time when we
had a lot of heavy ideas to work through,
and I think Ross was the perfect person to do
that album. With Arsenic In The Year Of The
Snake, for example, someone like Ross wants
to identify the true emotion of the song, and
we couldn’t have done that with anyone else.
The same with All Hail. It’s such an explosion of
emotions, with our friend in our mind [GWAR’s
Dave Brockie, who is named in the song, died
of a heroin overdose in 2014]. Ross was like the
lightning rod for those things.”
We’re happy to report, then, that
The Spark That Moves sees the
band rediscover their earlier party
hardcore settings and ramped
them up.
“This album has some harsh
moments, but there are some
party bangers, like Brightest Day
and We Run Free,” he brightens.
“With We Run Free, I sang that riff
into my phone while I was driving
north to meet friends to go dirt
biking. I remembered the types of
songs I used to hype myself up with
before going skateboarding and
just mouth-riffed it into my phone.
You can hear my demo at the start
of the song.
“I don’t think we could have
written those songs right away,” he adds. “It’s
come full circle and we’re feeling good.”
After returning from Winnipeg, the band
have been working extra hard in recent months
as they’ve gone DIY. The Spark That Moves will
DGVJGKTƂTUVTGNGCUGHQT$CV5MWNN4GEQTFU
“We’ve been so hands-on with the way
our deals worked,” he explains. “When it
came to the BMG deal [for Searching For
Zero], that’s what Noise Church [imprint] was.
We took the lead on our videos and gave
them to their team. When it came to this
TGEQTFYGFKFKVQWTUGNXGUCPFƂIWTGFQWV
distribution. It’s on our dime and from running
our own businesses, we made sure we’re not
overspending and that everything makes
sense. I’m not going to hand this over to
someone and just hope they sell it. Let’s make
all the pieces, let’s call people up and get
things going. Let’s make sure it’s a safe bet and
put our money where our mouths are.
“When Hail Destroyer came out, we were
living on whatever we could scrape by on,”
he adds. “We’ve made an entire career out of
ignoring what people think, so why start now?”
If you’ve picked up Kerrang! early, then the
band will be in the thick of their four-night
residency at The Underworld in Camden,
where 2,000 tickets have been snapped up by
eager fans. Does Liam think it’s important to
come back with new music while celebrating
the release of an album that’s a decade old?
“Because of the Bat Sabbath stuff and the
YC[YGƂPKUJGFVJG5GCTEJKPIUJQYUYG
weren’t scared to do a 10-year anniversary
because it doesn’t feel like a cash grab,” he
says. “It just felt like there wasn’t any pressure.
We’re doing these shows because we have
time to. I’m just psyched to party with people
who’ve had our backs since forever.”
Liam has said ‘party’ twice during this
interview. Of course this band were never
going to be away too long – the power of the
riff compels them.
“It’s what I love doing,” he beams. “I go dirt
biking with 60-year-old men who still have this
spark in them that makes them want to go out
and rip, and not just sit on the couch and let
the world pass them by. That spark is still alive
in me. We want to push ourselves as musicians
and get the party going still.”
We’ll drink to that.
THE SPARK THAT MOVES is out now
on bat skull records. cancer bats
are on tour in the uk now and play
DOWNLOAD IN JUNE – SEE THE GIG GUIDE
FOR INFOrmation
KERRANG! 47
RISING EMO STARS
H O P E
I S
I M P O R T A N T
Wrapped up in the rapid rise of California crew
MOVEMENTS are the struggles of frontman
PATRICK MIRANDA. But in the bravery of his
fight is an example for the band’s fans to follow…
Words: MISCHA PEARLMAN
48 KERRANG!
PhotoS: Kurt Cuffy
Sadly, not everyone
was into Patrick’s
emotional outpourings
F
or someone who says he
doesn’t like discussing his
feelings or mental health
issues, Patrick Miranda is
incredibly open and honest
about them. But then again,
anybody familiar with
California’s Movements and
their 22-year-old frontman’s confessional
lyrics probably wouldn’t be surprised at
his candour. Because for Patrick, his songs
are his life and his life is his songs. After
all, being diagnosed with OCD, bipolar
disorder and depression in his teens
remains his biggest muse.
“I don’t like to talk about my problems,”
he admits, right before proving himself wrong
over and over again. “I hate opening up, so
music is my way to do that. It’s like going to
therapy. Obviously, I still go to therapy, but
it’s a way I can work through my problems
without having to talk about them in normal
conversation with another human being.
I’m really bad at that. I write my songs from
a deeply emotional place. Everything I’ve
written about comes from experiences I’ve
had in my life. I don’t try to fabricate anything
for the sake of storytelling or having a
deeper impact.”
In reality, Patrick doesn’t need to. Whether
on 2016’s debut EP Outgrown Things or last
year’s sublime full-length Feel Something,
he and his bandmates – lead guitarist Ira
George, bassist/guitarist Austin Cressey
and drummer Spencer York – have written
thoroughly captivating songs, that, inspired
by the frontman’s battles with mental health,
drip with raw emotion. It’s that vulnerability –
that supremely vivid, unadulterated glimpse
into his struggles with his mental stability –
that make Movements such a vital, important
band. And for Patrick in particular, it’s quite
literally a lifeline; a way to confront the fact
that this is something he has to live with for
the rest of his life. There is light at the end of
the tunnel, but he’ll never not be moving out
of the darkness.
“When it comes to depression,” he
explains, “there’s always going to be ups
and downs. That’s what the song Full Circle
is about. There’s always going to be a point
where you’re at the lowest of the low and it
feels like nothing will ever get any better, but
eventually you end up coming out of that.
KERRANG! 49
I don’t know what it is that brings you
out. Being on medicine always helps,
going to therapy, being around friends,
being a part of the music scene and
writing music – those are the things
that have helped push me through the
darkest times that I’ve had. But on the
opposite end of that, even when you’re
at your highest, when you’re at the top of
the world, eventually it’s going to swing
back down. That’s just the chemical
imbalance, the cycle of depression.”
Perhaps because he’s aware of that
cycle – or perhaps just because he’s
been in and out of it enough times by
now – it never got so bad for Patrick
that he didn’t see a way out. Rather,
thanks to his close support network, the
punk scene and the band, he’s always
managed to get close enough to that
sliver of light to keep going.
“Giving up has never been an
Someone didn’t get the
option,” he says, “and I don’t think it
hands in pockets memo
should ever be an option for anybody.
I understand that some people give in
to mental illness and giving up looks like
it’s the only way out, but I personally have never
through exactly what I’ve gone through. I want
gotten to that point. I’ve always known I’m going
our songs to be open to interpretation, so no
VQƂIJVDGECWUG+NQXGO[NKHGCPF+NQXGVJG
matter what it is you might be struggling with,
people in my life. I have so much to live for that
our music can help push you through that and
giving up has never been a legitimate option.
let you know you’re not alone. Because I think
But I also know that’s a personal thing and other
that’s really important for recovery too – just
people might not feel that way.”
knowing there are other people out there who
While Patrick’s depression, mental health
know what exactly it is you’re dealing with and
issues and his resulting emotional vulnerability –
how to help you with it.”
he readily admits that he was bullied at school,
that he never had more than a couple of friends
at one time and that he’s always struggled with
JKUEQPƂFGPEGsCTGEGPVTCNVQVJGDCPF
CUKUJKU
battle against those things), he’s keen to point
out that he writes about these things because
he needs to.
“I think there’s a huge misconception right
now that talking about mental illness or writing
sad music is just trendy,” he says. “I really hate
that ‘sad boy’ trend, the fact that it’s sort of
discrediting mental illness. Mental illness should
never be used as a gimmick. It’s not a joke and it’s
P A T R I C K M I R A N D A
not something to take lightly and it certainly isn’t
UQOGVJKPIVQRTQƂVQHHHQTVJGUCMGQHRTQƂVKPI
It’s much, much deeper than that.”
To that extent, Movements is not just a
cathartic outlet for Patrick. While it is that, it’s also
hat altruistic approach extends way
a chance for the band to help others; to show
beyond Movements’ music, too. When
their fanbase – which has been steadily growing
the band made the moving video for
since the quartet formed in 2015, especially
Deadly Dull, a song about dealing
after signing to Fearless Records – or really just
with Alzheimer’s disease, from which Patrick’s
anyone that’s listening, that there is always hope,
girlfriend’s grandfather suffers, they partnered
no matter how bad things might seem, and even
with the Alzheimer’s Association to spread
if you’re experiencing different problems to the
awareness about the condition. The band also
ones that Patrick writes about.
work on a regular basis with an organisation
“We want our songs to be open-ended,” he
called Finding A Lost Voice, too.
UC[Up,WUVDGECWUG+YTQVGVJGOCDQWVCURGEKƂE
“They’re a mental health and addiction
part of my life doesn’t mean that in order to
TGEQXGT[PQPRTQƂVqVJGXQECNKUVGZRNCKPUp9G
relate to these songs you have to have gone
want to make sure that we’re creating a positive
“I REALLY HATE THAT
‘SAD BOY’ TREND. IT
ACTUALLY DISCREDITS
MENTAL ILLNESS”
T
IT’S GOOD
TO
TALK
If you recognise
yourself in PATRICK’s
experiences, he has a
message for you…
50 KERRANG!
“My biggest piece of advice
is, don’t be afraid to talk
about these things. I’m guilty
of that, but coming to terms
with your mental illness and
accepting that talking about it
is the only way it’s going
to get better is a big
first step. Find
that confidence
to find someone that you’re
comfortable talking to,
whether that’s your mum or
dad, your brothers, sisters,
or your best friend. It could
even be an online forum or
mean going to a therapist.
“No matter how much
it makes you cringe or
the thought of talking
impact and that goes further than
music. It’s us giving back because this
is real and important to us. I want to
make sure that kids know they’re not
alone, that there is camaraderie here
and people who understand them.”
+VoUVJCVXGT[ECOCTCFGTKGVJCVƂTUV
drew Patrick out of the shell of his
mental illness so that he could begin
to confront it. He found it in the punk
scene and he’s dedicated to continuing
it with his own band, his own songs,
and his own actions. And while he’s not
naive enough to discount the effect
that counselling and medicine have
had on his well-being, he’s absolutely
aware that he wouldn’t be who or
where he is today without the band.
Which is why, for him, these songs are
more than just songs. They’re his heart
and his soul and his life experience, all
laid on the line.
“When people hear our music,” he
says, “I want them to feel it, not just
listen to it. I want them to understand
it. I want it to be a profound
experience, not just, ‘That was a good record.’ I
want people to connect to it in a deeply personal
and emotional way. All I care about is that it’s
something more than just listening to music.”
That he cares so much about his band and
their songs demonstrates precisely how much
this band means to him, both in terms of how
it’s helped him and how he can now use it to
help others. For Patrick, being so emotionally
QRGPKPUQPICPFKPEQPXGTUCVKQP
OWEJCU
he may disagree) has given him strength to
tackle his issues. Which is to say, tackle who he
is and always will be. Because as much as he’s
better, he’ll never not suffer. The ultimate irony,
however, is that he wouldn’t change that for
the world. After all, the band and all the songs
they’ve written only exist because his condition
compelled him to write them. That might sound
like small comfort, but in fact, Patrick is coming
to terms with having to deal with the chemical
KODCNCPEGVJCVFGƂPGUJKOsCPFVJGHCEVVJCVoNN
never actually change.
“There isn’t really a cure,” he admits. “It sucks
knowing that I’ll never be completely normal. I’m
never going to be totally happy, but are people
who don’t suffer from depression or anxiety
GXGTRGTEGPVJCRR[QTUCVKUƂGF!6JCVoULWUV
the human condition. I know that sounds super
weird, but it’s almost a comfort knowing that it’s
something that I deal with. It’s never going to
go away, but I know that so far I’ve always come
through it and I can do so again in the future.”
FEEL SOMETHING IS OUT NOW ON FEARLESS
records. MOVEMENTS ARE ON TOUR IN THE
UK NEXT MONTH – SEE THE GIG GUIDE FOR
INFOrmation. if you are affected by
any mental health issues, please Check
out youngminds.org.uk
about these things hurts your
soul, I get it. But it’s important
to be open and honest.
“Secondly, finding an
outlet is such an important
thing to do. Even if you’re
not musically inclined, that
doesn’t mean your outlet can’t
be the music community,
because it was for me before
I was playing music. Going
out and having a group of
friends who understood me
and what I was dealing with
was so important. Whatever
it is that makes you feel
happy and lets you relieve
some of the stress or anger
or sadness, please find it and
don’t let go of it when you do.”
Watch
this
space...
E X C L U S I V E
L I V E
A L L - R E V E A L I N G
R O C K
A C T I O N
A N D
F R O M
A
T H E
W H O L E
S E T S !
I N T E R V I E W S !
K E R R A N G !
L O T
V A U L T S !
M O R E …
SUBSCRIBE
NOW OR MISS OUT
FOREVER!
K! PIT FOR
VE ENTER THE
I
R
D
Y
A
W
K
R
A
: P
VELY HERE
NOW SHOWING
L SET EXCLUSI
L
U
F
E
H
T
E
E
S
ST GIG EVER!
THEIR SMALLE
KKKKK = CLASSIC KKKK = EXCELLENT KKK = GOOD KK = AVERAGE K = POOR
Those luxury seats at Vue
cinemas are really worth the
extra money, aren’t they?
52 KERRANG!
Q&A IHSAHN
RETHRONED
EMPEROR
Norwegian black metal pioneer IHSAHN
invites you into his prog-tastic domain on
expertly-forged solo album
I
t is intriguing, a quarter of
After the icy isolation of 2016’s
a century later, to look at
Arktis, Ámr (the Norwegian word
Norwegian black metal’s
vÀ`>ÀiÃîw`ÃÃ>Ì>}
graduating class of 1993 and
a slightly more welcoming tack.
ÁMR
see just where everyone is
Warm synths and fat guitars set
(CANDLELIGHT)
now. Because, against all odds,
the tone on Lend Me The Eyes
out of the madness, murder and
"vi>]>ÃÌiyÕiViv
matches-and-churches crime its
‘70s prog entices you into Ihsahn’s
constituent bands were involved
shadowy world, rather than leaving
in, all carried on, and continued
you stranded and alone on some
on their own musical quests. And
frozen tundra, as he’s been known
in some cases, they’ve surpassed
to in the past. This is introspective
their early works, while keeping
darkness of the staring-at-thethe same spirit gloriously blazing.
i
LiÀÃv>}wÀi>ÌÎ>
>Ã
Mayhem, for example,
whisky-drunkenness-takes-hold
have taken the cold, scything
variety. Not necessarily a dark night
slashes of their De Mysteriis
of the soul, but a good soundtrack
Dom Sathanas album and
for it nevertheless, should that be
followed them deep into
ÜiÀiÞÕ>««iÌw`ÞÕÀÃiv°
the abyss, creating works of
It gives the album’s attack a
atonal weirdness that continue to plumb
subtle edge. Arcana Imperii has fast guitars
the depths of musical darkness. Darkthrone
and frantic drums, but the clarity and warmth
have continued to take heavy metal to ever
of the production, not to mention the soaring
more primitive depths, while displaying a
chorus, make the darkness here a comfortable,
surprisingly large musical spectrum for such
introspective twilight. The piano-led Sámr
a narrow remit, while Ulver have reinvented
vÜÃÃÕÌ]ÜiÌiÃVwÃÕ`ÌÀ>Vv
themselves as Norwegian black metal’s answer
Rites Of Passage gives way to a more gentle
to electronic artists like Portishead. Emperor
movement in its bridge, with Ihsahn quietly
frontman Ihsahn, meanwhile, has hopped on
singing, ‘I could cut you open with a word’ in
the bus marked ‘Prog’, but taken the steering
a far more threatening manner than if the line
wheel, and driven it to odd new places.
had been delivered with a scream.
Indeed, his course in 2018 may seem a
Throughout, the musical skill and
departure from his days fronting Emperor,
compositional creativity is the work of a
but one must remember how that band never
master craftsman. With Ihsahn playing
stood in one place longer than the creative
everything, bar the drums, you have to marvel
impulse held them there. Thus, just as that
at the man’s superior musical skills, while his
band twisted and evolved immeasurably
songwriting remains intelligent, fearless, and
across their four albums, so too has their
with its complexity and depth delivered in a
main composer made incredible musical
deceptively accessible wrapping.
strides on each of his seven solo records. But
In times past, Ihsahn and Emperor did the
what is crucial here is that, for Ihsahn and his
unthinkable by earning black metal respect and
contemporaries, though the song has not
credibility. Here, he continues to pull you into
remained that much the same, the individual
his rabbit hole with spectacular results. Once
strains of darkness that drove each one remain
again, all hail the emperor. N I C K R U S K E L L
as shadowy and abyssic as in the beginning.
IHSAHN
KKKK
(VOCALS/GUITAR/BASS/KEYBOARD)
What did you want to
create with Ámr?
“I had some very clear
ideas, going in. I had a concept…
Well, not a concept – a seed.
I wanted to focus on analogue
synthesizers and intimate, close
sounds. I wanted it panned hard
– left, right, centre. I wanted no
sustained cymbals, and an acrylic
drumkit, so there’s almost an
ABBA or Motown feel on the
drums. Not modern! Combine that
with 808s and synthesizers and
it becomes its own record. If you
listen to old recordings of Black
Sabbath, all the instruments were
hit hard – you didn’t get anything
for free. So the parameters of
Black Sabbath or Led Zeppelin
were in one way quite limited,
but there’s a lot of energy there
because of how they had to play.
But I have so many different
i
yÕiViði ,>`i>`]ÜiÀi
they have panned, tilted, off-kilter
gs
production, I thought about thing
like that when I was making this
record as well.”
“I’M VERY
STRONG-MINDED
ABOUT MY MUSIC”
IHSAHN
What does the title mean?
“Dark, or murky, or rusted. Which
is kind of perfect if you see
the imagery. It’s not black and
white, it’s almost monochrome,
but there’s this red glow. It was
suggested by Heidi, my wife –
she understands my conceptual
ramblings! She’s probably my
ÃÌyÕiÌ>
]LÕÌ
i>ÃÌVÀi`Ìi`
collaborator, actually.”
As a solo artist, is it liberating to
call all the shots, rather than present
something to a band and have them
go, ‘Nah’?
“In a way, but I still do that. I can
show something to Heidi, and she
can go, ‘That’s crap.’ Then I have
to scrap it! She’s one of the few
people who can get to me. I might
be very easy-going, but when it
comes to my music… I took the
consequences when I went solo!
I’m very strong-minded about my
ideas. Not that I think my ideas
are better than anyone else’s, but
when an idea’s stuck in my head,
I have a hard time shaking it.”
KERRANG! 53
REVIEWS
Surprise! From out of
nowhere, BILLIE JOE
ARMSTRONG’s latest
side-band unveil their debut
A
RTKNYCU
a big day
for bands
LOVE IS FOR LOSERS
UWTRTKUG
(The Longshot)
releasing
new records. Cancer Bats
FTQRRGFVJGKTUKZVJCNDWO
6JG5RCTM6JCV/QXGUQWV
of nowhere, with loads of
XKFGQUVQDQQV1CMNCPF
UVQPGTNGIGPFU5NGGRRWV
down the bong long enough
VQHTGCMQWVVJGKTHCPUYKVJ
6JG5EKGPEGUVJGKTƂTUVPGY
album in nearly 20 years
moments. While there’s a decent
DGECWUGKVYCUQP
RCEGVQUQPIUNKMG$QF[$CICPF%WNV
the American calendar, and
*GTQKVoUPQVVJGECHHGKPCVGFTWUJ
there’s a song on it called
QHRWPMTQEMOQTGVJGUQTVQHVJKPI[QW
Marijuanaut’s Theme so… yeah maaaan).
KOCIKPGRTG4COQPGUOGODGTUFCPEKPI
$WVGXGT[QPGYCUTQWPFN[IC\WORGFYJGP
VQCVVJGKTJKIJUEJQQNRTQO+VUQWPFUCNQV
$KNNKG,QG#TOUVTQPIFGEKFGFVQIGVKPQP
NKMGVJGOCPoUFC[LQDDWVVJKUKU$KNNKG,QG
KVCUYGNN*CXKPIURGPVVJGRCUVEQWRNGQH
#TOUVTQPIYTKVKPICDWPEJQHUQPIUVJCVoU
YGGMUECUWCNN[WRNQCFKPIPGYUQPIUD[JKU
NKMGDGKPIUWTRTKUGFYJGP[QWIQVQ*GUVQP
new band, The Longshot, Love Is For Losers
Blumenthal’s house for lunch and he doesn’t
suddenly emerged that day. Although he
just give you a cheese sandwich.
FKFCEVWCNN[IKXGWUVJGJGCFUWRYJGPJG
6JG.CUV6KOGCPF-KNN;QWT(TKGPFUƂPF
RQUVGFVJGƂTUVUQPIUs6CZK&TKXGT%JCUKPI
$KNNKG,QGoUN[TKEUHQEWUKPIOQTGQPVJGUQWN
#)JQUVCPFVJGVKVNGVTCEMsUC[KPIVJG
YKVJKPVJCPVJGRQNKVKEUQWVUKFGCUJGFKFQP
album was “Coming eventually sooner or
4GXQNWVKQP4CFKQ6JGTGoUCNUQCUWTRTKUKPIN[
NCVGT2TQDCDN[UQQPGTeq6JCPMUOCVG
IQQFEQXGTQH1\\[oUDTGCMWRJKV)QQFD[G
So, here it is. Love Is For Losers is a
6Q4QOCPEGYJKEJJGTGKUVTCPUHQTOGFHTQO
TGEQTFUVGGRGFKPVJCVYQQ\[UVKPIGF
CRQYGTDCNNCFKPVQUQOGVJKPICRRTQCEJKPI
#OGTKECPCVJCVOCMGUWRVJGYCTOJGCTV
a lost tune from the American Idiot musical.
QH)TGGP&C[oUOQTGNCKFDCEMOKFRCEGF
THE LONGSHOT
PHOTO: ALEX LAKE
KKK
54 KERRANG!
.QXG+U(QT.QUGTUKUPQV$KNNKG,QG
KPFWNIKPIKPWPGZRGEVGFVJKPIUJGEQWNFPoV
normally do in Green Day. But you feel
that showing off some avant-garde side to
JKURGTUQPCNKV[QTUETCVEJKPICNQPIJGNF
VGEJOGVCNKVEJKUPoVVJGRQKPVJGTG9KVJ
)TGGP&C[oU4GXQNWVKQP4CFKQVQWTGPFKPI
last November, a clear diary, and no other
activity from them save a few tiny shows
where they horsed about doing classic
EQXGTUQXGTVJGNCUVEQWRNGQHOQPVJUENGCTN[
VJKUKUCOCPYJQECPoVJGNRYTKVKPICPF
RNC[KPIUQPIUYTKVKPICPFRNC[KPICNQCFQH
UQPIUYKVJPQRTGUUWTGPQITCPFRNCPCPF
LWUVCEQWRNGQHOCVGUNQQMKPIHQTCNCWIJ
#PFVJCVoUCRCTVQHVJGOCPYGCNNMPQYCPF
NQXG#NVJQWIJJGRTQDCDN[QYGU%CPEGT
$CVUCPF5NGGRCPCRQNQI[PQVG N I C K R U S K E L L
BAD WOLVES
BOSS KELOID
QUEEN KWONG
(ELEVEN SEVEN)
(HOLY ROAR)
KKKKK
KKKKK
(EDISON SOUND)
FOR FANS OF: Five Finger
Death Punch, DevilDriver, Soilwork
FOR FANS OF: Mastodon,
Conjurer, Slabdragger
DISOBEY
QConsisting of ex-members of DevilDriver, God
Forbid, Bury Your Dead and In This Moment, Bad
Wolves might as well have called themselves the
Ex-Men. Particularly as elements of those former
QWVƂVUDWDDNGWRHTQOVKOGVQVKOGJGTG;QWOKIJV
also recognise frontman Tommy Vext from his stint
ƂNNKPIKPHQT+XCP/QQF[KP(KXG(KPIGT&GCVJ2WPEJ
6JGTGoUCEQORCTKUQPVQDGFTCYPVJGTGYKVJVJG
down-tuned riffs and muscular vocals, but Bad
9QNXGUCTGCPKODNGTRTQRQUKVKQP6JGTGCTGFTKNNKPI
OGVCNEQTGTJ[VJOUEKTEWNCTRCVVGTPUYKVJRTQITQEM
RTGVGPUKQPUCPFVJGKTEQXGTQH6JG%TCPDGTTKGUo
<QODKGYCUC75JKVCPFNQQMUNKMGKVoNNDG
UJCODNKPICTQWPFTQEMENWDFCPEGƃQQTUHQTCNQPI
VKOGVQEQOG&GURKVGVJGXCTKGV[QPQHHGTVJGNGCP
RTQFWEVKQPCPFHTGSWGPVTGVWTPVQHQTOWNC
VCMG
ETWPEJKPIFKUVQTVKQP#CPFCHƂZVQUQCTKPIOGNQF[
B) leave it sounding samey after a while, which
grates when the album is this bloody long.
It’s a solid but WPURGEVCEWNCTFGDWV. P A U L T R A V E R S
MELTED ON THE INCH
QThose familiar with Boss Keloid’s strange
brew already regard their name as a byword for
EQPUEKQWUPGUUYCTRKPIUNWFIGVJCVƃKTVUJGCXKN[
YKVJRTQII[QDNKXKQP*GTGQRGPGT%JTQPQUKCO
KUVTWGVQVJCVHQTOWPHQNFKPINKMGCITQIUQCMGF
UGCUJCPV[CU2CWN5YCTDTKEMTCXGUKPVQVJGCD[UU
;GVGXGPVJGEQPXGTVGFYKNNƃKRVJGKTNKFUYJGP
VJG[UCORNGVJGPGYGNGOGPVUDWDDNKPIDGPGCVJ
VJGUWTHCEGQHVJG9KICPSWKPVGVoUNCVGUVQHHGTKPI
.QMCPPQMoUTWDDGT[DCEMDQPGKUOCFGQHUKPWQWU
HWPMYJKNG2G[MTWXGoUUMCPMKPIKPVTQFWEVKQP
OCUJGUUVKEM[TGIICGYKVJKEM[FQQO6JGTGEGPV
CFFKVKQPQHMG[UVYKFFNGT/CVVJGY/KNPGCNUQCFFU
FTQPKPIOCNGXQNGPEGVQ6CTMW5JCXGNCUKH&GGR
2WTRNGoU,QP.QTFJCFDGGPKPFQEVTKPCVGFKPVQ
CEWNV6JKUKUPQV[QWTV[RKECNDQPIUVQVJGYCNN
UNWFIGHQFFGTDWVCPKOOGTUKXGVTKRYKVJOQOGPVU
QHENCTKV[VJCVRWPEVWCVGVJGINQQO5QKH[QWoTG
PQV[GVCESWCKPVGFFTKPMFGGRDGECWUGVJKUKU
RTQII[UNWFIGDTKNNKCPEG J A M E S M A C K I N N O N
LOVE ME TO DEATH
KKKKK
FOR FANS OF: Queens Of
The Stone Age, The Icarus Line, Garbage
QIf Queen Kwong’s Carré Callaway has often
been discussed in relation to her more famous
EQNNCDQTCVQTUUWEJCU6TGPV4G\PQTVJKUUGEQPF
CNDWOUJQWNFFKXGTVCNNVJGCVVGPVKQPƂTON[KPJGT
direction. Love Me To Death is a startling odyssey
KPVQJGTKFKQU[PETCVKEXKUKQPRCEMGFYKVJFKXGTUG
UQPIUCUFCTMN[GOQVKQPCNCUVJG[CTGOWUKECNN[
GZRNQUKXG6WPGUNKMG4CRVWTGUCPF9JKVG9JKPG
QHHGTUNKIJVN[UMGYGFXGTUKQPUQHVJGUQTVQH
CNVTQEMVJCVETQUUGFKPVQVJGOCKPUVTGCOKPVJG
nUYJKNGVJGRWPMHTGCMGT[QH(QQNU)QNFCPF
5WP1H.KHGUKVCNQPIUKFGOQTGVGPFGTRKGEGU
NKMG1NF(CKVJHWN(QT3WGGP-YQPITGUKFKPIKP
LA is evidently no barrier to harnessing sonic
GEJQGUQH0;%CTVTQEMJGTQGU5YCPUCPF$QUU
*QIYJKNG2TGJKUVQTKE$NWGUDQCUVUQPGQHoU
OQUVRQYGTHWNOQOGPVUYKVJCPKORGTKQWU%CTTÅ
declaring ‘;QWDGVVGTYCVEJ[QWTDCEM’ The only
thing you’re gonna want to watch, however, is this
incredible band. O L L Y T H O M A S
KING GOAT
WOES
BEHEMOTH
(AURAL MUSIC)
(UNFD)
(NUCLEAR BLAST)
KKKKK
KKKKK
KKKKK
FOR FANS OF: Pallbearer,
Candlemass, Electric Wizard
FOR FANS OF: blink-182,
Moose Blood, Neck Deep
FOR FANS OF: Satyricon,
Morbid Angel, Skeletonwitch
QThere’s a thin line between wilful weirdness and
DQWPFCT[UJQXKPIRTQITGUUKQP$TKIJVQPFQQOUVGTU
King Goat tread all over it with shuddering heft
CPFOCUVGTHWNFGZVGTKV[JGTG9JGVJGTKVOCTMUC
FGUEGPVKPVQFCTMPGUUQTWRVJGUVCKTYC[VQOGVCN
JGCXGPKUsDTKNNKCPVN[sPGXGTGZRNKEKVN[ENGCT9G
IGVPQFUVQ)TCPF/CIWUoEJGUVVJWORKPIVTCF
OGVCN
4CRVWTG$NCEM5CDDCVJoUHWTPCEGHQTIGF
TKHHCIG
'TGOKVGoU4GUVCPFVJGIQWIKPIOGNQFTCOC
QH%CPFNGOCUU
&GDV1H#GQPU$WVVJGTGCTG
URKPGVKPINKPIFKXGTUKQPUKPVQGUQVGTKEKUOVQQ
with haunted instrumental Psychasthenia blowing
VJTQWIJNKMGCYKPVGTYKPFDGHQTG
VJGQUVGPUKDN[
WPVKVNGFnsoFTQRUKVUUVTCPIGUGEQPFUSWCNN
It’s on the home-straight, though, that King Goat
WPURQQNVJGKTHWNNRQVGPVKCNYKVJ&QNFTWO5GPVKPGNU
RNC[KPIINGGHWNN[YKVJVQPGCPFVGORQDGHQTG
OKPWVGRNWUENQUGT1P&WUV[#XGPWGU
VWODNGUVJTQWIJCNNCRQECN[RVKEJGCXKQUKV[
CPFCVOQURJGTG*CKNVQVJG)QCVS A M L A W
Q+P)NCUIQYVQRRGFCRQNNQH6JG&WNNGUV
%KVKGU+P'WTQRGCHVGTTGUGCTEJHQWPFKVTGEGKXGU
LWUVJQWTUQHUWPUJKPGC[GCT1HHVJGDCEM
QHVJCV[QWECPRGTJCRUUGGYJ[5EQVNCPFKUPoV
GZCEVN[RWORKPIQWVRQRRWPMDCPFU+VoUJCTFVQ
VJKPMQHQPGYJQoUCEJKGXGFCP[NGXGNQHUWEEGUU
DWVVJCVNQQMUUGVVQEJCPIGYKVJVJGCTTKXCNQH
9QGU6JGKTPCOGCNQPGOCMGUVJGOUQWPFXKVCOKP
&FGƂEKGPVDWVVJGUQPIUHQWPFQPFGDWVƂXG
VTCEM'25GNH*GNRCTGHCTHTQOFWNN*KIJ1P;QW
MKEMUQHHYKVJGCTN[DNKPMXKDGUDGHQTGUNKRRKPI
KPVQCPWPGZRGEVGFGVJGTGCNOKFFNGGKIJV7PNWEM[
in-love number Losing Time favours raw and
GOQVKQPCNQXGTRQNKUJGFRTQFWEVKQPOCMKPIKVHGGN
GCTVJ[CPFYCTO%NQUGT*.$OGCPYJKNGDGIKPU
NKMGCP4oPo$UQPIsVJKPMCEJKNNGFQWV+UUWGUs
UJQYKPIVJGSWCTVGVoUFKXGTUGKPƃWGPEGUCPFKVoU
VJKUGNGOGPVVJCVUGVUVJGOCRCTVCPFIKXGUVJGKT
VCMGQPRQRRWPMCTGHTGUJKPIVYKUV9JQPGGFU
sunshine, anyway? J E N N Y F E R J . W A L K E R
QSeeing Behemoth live is an exercise in sheer
force rarely encountered outside of a nuclear test
UKVG6JWUKVoUIGPWKPGN[KORTGUUKXGVJCVUWEJC
NCTIGCOQWPVQHVJCVDWNNFQ\KPIRQYGTJCUDGGP
ECRVWTGFCPFETCOOGFKPVQVJKUNKXGCNDWOCPF
&8&YJKEJUGGUVJG2QNKUJDNCEMOGVCNCPVKJGTQGU
raging through their excellent The Satanist album
in full at two shows, one in Poland, the other
CV%\GEJ4GRWDNKEoUCRVN[PCOGF$TWVCN#UUCWNV
HGUVKXCN(TQPVOCP0GTICNJCUVJGRTGUGPEGQH
CYCTNQTF
CYCTNQTFEQXGTGFKPEQTRUGRCKPV
CFOKVVGFN[CPFUQPIUUWEJCUVJWPFGTKPIQRGPGT
$NQY;QWT6TWORGVU)CDTKGNCPFVJGCIITGUUKXG
Satanic whirlwind of Ora Pro Nobis Lucifer are
delivered with an energy that’s barely contained,
DWVRTGEKUKQPVQQNGF%NQUGT1(CVJGT15CVCP1
5WPKUCNOQUVCPVJGOKEKPKVUEJCPVNKMGEJQTWU
CPF[QWECPJGCTVJGƂPCNDKVUQHGPGTI[DGKPI
YTWPIHTQOVJGDCPFCUKVENKOCZGU0QYEJCRU
PGYCNDWORN\ N I C K R U S K E L L
DEBT OF AEONS
THE KENNETHS
EX
(Self-released)
KKKKK
FOR FANS OF: Green Day,
NOFX, Rancid
QWith their tightly constructed and always
highly caffeinated songs, The Kenneths are
QPGQHVJGDGUVPGY
KUJRWPMTQEMDCPFUKP
Britain. Consistent with this, the London trio’s
NCVGUV'2VJGCKTNGUUCPFKTTGRTGUUKDNG'ZLGTMU
CPFDQWPEGUNKMGCFGNKPSWGPVTCKUGFQPCFKGV
QHIQHCUVGTFTWIUCPFGPGTI[FTKPM*GTGVJG
RWPEJEQOGUPQVQPN[HTQOVJGSWCNKV[QHVJG
UQPIUsVJGUQCTKPIEJQTWUQH(CXQWTKVG'ZCPF
VJGTGNGPVNGUURTQRWNUKXGVJTWUVQH/QFGN/CP
CTGRCTVKEWNCTN[KORTGUUKXGsDWVCNUQHTQOVJG
strength of the band as a musical unit. This is
CRQYGTVTKQYKVJVJGGORJCUKUQPVJGRQYGT
VJGTJ[VJOUGEVKQPKUVKIJVCPFKPUKPIGT,QUJ
9GNNGTVJGWPKQPKUGSWKRRGFYKVJQPGQHVJG
OQTGEQOOCPFKPIRTGUGPEGUKPFQOGUVKERWPM
TQEM'ZKU6JG-GPPGVJUoHQWTVJ'2GCEJQHYJKEJ
bursts with strong material. When they get around
to recording a full-length album, in terms of
UWUVGPCPEGKVYKNNDGCTGYCTFKPIGZRGTKGPEGHQT
all. Until then, this short but brilliant collection of
UQPIUYQTMUCNOQUVCUYGNNI A N W I N W O O D
SELF HELP
MESSE NOIRE
SCREAM
NMC17
(SOUTHERN LORD)
KKKK
FOR FANS OF:
Nirvana, Pixies, The Menzingers
Q4GEQIPKUGVJCV[QWPIHGNNCKPVJG
middle, over there? That’s right, it’s
Dave Grohl, and the band are DC
RWPMQWVƂV5ETGCOPQVDKI&CXGoU
ƂTUVDCPFDWVVJGƂTUVQPGYKVJ
YJQOJGOCFGCTGEQTFoU
0Q/QTG%GPUQTUJKR*CXKPIDGGP
QWVQHRTKPVHQT[GCTUVJGCNDWO
has been remixed and remastered
CV&CXGoU5VWFKQƂTUVHQTNCUV
[GCToU4GEQTF5VQTG&C[CPFPQY
for general release. It’s given these
TCEKPIOGNQFKERWPMVWPGUCDGGH
WROKUUKPIHTQOVJGQTKIKPCNVJCV
IGPWKPGN[KORTQXGUQPVJGQNFXGTUKQPoUUQOGYJCV
VJKPUQWPFOCMKPIVJGUQPIUUQWPFOCUUKXG
So why are they doing this now? Well, for one
VJKPIVJGOCUVGTVCRGUYGTGVJQWIJVVQDGNQUV
until they were found gathering dust in storage.
$WVCUCOQTGRQKIPCPVGZRNCPCVKQPHTQPVOCP2GVG
5VCJNRQKPVUQWVVJCVVJGCEVKXKUVDCPFOCFGVJG
TGEQTFFWTKPIVJG4GCICPGTCYJGPRWPMPGGFGF
VQOCMGCPQKUG#UJGQDUGTXGUKPVJGUNGGXG
PQVGUp*KUVQT[TGRGCVUq$WVYJGVJGT[QWoTG
DW[KPIVJKUHQTVJGOGUUCIGDGECWUG[QWNKMG
VJGQTKIKPCNQTVQJGCTVJGKTFTWOOGToUƂTUV
UVGRUVJKUTGOCKPUCHCPVCUVKErecord, saved
from obscurity in a noble fashion. N I C K R U S K E L L
KERRANG! 55
CODE ORANGE
+ EMPLOYED TO SERVE
KKKKK = CLASSIC KKKK = EXCELLENT KKK = GOOD KK = AVERAGE K = POOR
THE CLUNY, NEWCASTLE
18/04/2018
KKKKK
Photos: NAT WOOD
CODE ORANGE
take on the Toon
at intimate show
56 KERRANG!
T
here’s a moment during tonight’s
chaotic, violent maelstrom where
Code Orange almost – almost –
allow themselves to crack a smile.
ÛiÀÞiÞiÌiÛiÕiÃwÝi`
them, every body crammed into its sold-out,
split-levelled space is saturated in sweat,
every mind is bending to the distilled schizoid
intensity of their sound. Headline shows for
the Pittsburgh steelers, see, have become
few and far between. “We’ve been working
fucking hard, for a long fucking time, opening
for other bands,” growls percussionist/
singer Jami Morgan, alluding to the fact that
even this show is squeezed into an off-date
from opening for Trivium on their current UK
tour. “This feels really good!” As half-grins
turn back to grimaces, it’s brutally apparent
that their bloodstained New Reality is best
iÝ«iÀiVi`ÌëÕÀiÃÌv vÀð
Opening tonight should be a thankless task.
Woking brutalists Employed To Serve, to the
contrary, relish the chance to test themselves
against their Transatlantic counterparts.
“Wake the fuck up, Newcastle!” roars guitarist
Sammy Urwin as their churning, grinding
attack begins. One punter duly picks up the
person to his left and hurls them halfway
across the room. Sammy and singer Justine
Jones uncork the title-track from last year’s
Performing beneath solid red light, Code
astonishing The Warmth Of A Dying Sun,
Orange unload each brutal attack with
before a bulldozing I Spend My Days (Wishing
uniform intensity. But they’re also moving
Them Away) drops like a sonic anvil. Like
across a metallic landscape. Real and Spy
souls being pulled under by their tidal force,
soundtrack the chaotic incline, while Bleeding
though, it feels like most in attendance are
In The Blur (a deafening sing-along), I Am
holding their breath.
King (still shit-yourself terrifying) and new
Code Orange don’t
single Only One Way
take long to knock it out
deliver a bracing mid-set
of them. An ambulance
plateau where even the
siren sounds as their
odd sonic imbalance feeds
intro-tape comes in, and
into the sense of visceral
already-bloodied bruisers
strangeness. It’s the
glance at each other,
insistence that things spiral
relishing the portent. The
off – through Forever, The
wÀÃÌÃÌ>}i`Ûi ViÃ
Mud and dream2 – into
seconds later, as guitarist
nightmare wooziness rather
Dominic Landolina swings
than curtain-dropping
off the lighting-rig before
bombast that remind us
VIEW FROM THE
anyone’s even struck a
we’re here on their terms.
chord. As a furious My
“They hate us,” seethes
World detonates, folk
Jami at one point, relishing
Something oft missing from merch areas
are hurling themselves
the carnage unfurling
the world over are shop mannequins,
off the low balcony and
around him. “They imitate
showing off what your new clothes will
headlong down stairwells.
us. But they all know
look like. Code Orange obviously spent
/i>
Ài>`ÞÃÌy}ë>Vi
one fucking thing: CODE
good money on theirs – just look at the
becomes a furnace, and
ORANGE IS FOREVER!”
PMJIPMOIJIEXYVIW3RP]FVMI¾]HMHMXQEREKI
it’s a vicious, intense,
Believe it. S A M L A W
to fool us into trying to give it money…
beautiful pandemonium.
MERCH DESK
Q&A JAMI
MORGAN
(VOCALS/DRUMS)
Well, that was intense…
“It was great! The other shows
[with Trivium] have been bigger,
but this was a room full of our
fans. I really felt like it reignited
my spirit! It was just fucking
animalistic – chaotic!”
How do these gigs differ from the
shows with Trivium?
“It’s 100 per cent different. They
have their crowd, who seem to
CNYC[UƂNNWRVJGƂTUVTQYU
and they just wait. The back
half of the shows always seems
to be full of people there to
catch us and Power Trip, too.
We’re up there killing it every
night – I’ve got cuts all over my
hands, the other guys have cuts
over their faces! We’re going
after it every night! You’ve
got to remind motherfuckers
who you are – we aren’t here
v
just to support! I dig going
on the attack! I can handle
the antagonistic stuff when it
happens, too. The other night,
someone was shouting ‘FUCK
YOU!’ So I just shouted ‘Fuck
YOU!’ right back!”
What stands out about being in
the UK?
“The roads here suck! And
there’s nowhere to eat on the
road except McDonald’s – what
the fuck is up with that? Where
is the Chipotle, or any healthy
shit?! Seriously, though, the
thing that always stands out
about the UK is getting to meet
a lot of great fans. Getting to
play shows like this just feels
so fun and rewarding.”
FACE IN THE
CROWD
Code Orange shows: oddly
suitable for developing photos
Is this you all sweaty after getting
brutalised by Code Orange? Well,
you’ve won a T-shirt! Send a pic
of yourself and your ticket to
Feedback@kerrang.com to claim
your prize!
KERRANG! 57
WONDER
BOYOS
Photos: ANDY FORD
Welsh post-hardcore
crew CASEY hit a
cathartic high in London
QMoments are built from small things.
Those little details that make something truly
special, which you don’t necessarily notice
when they’re there, but their absence turns
everything upside down. With understated
intensity, Casey gigs are communions for such
moments. The effect of songs from this year’s
“Stop! That tickles!”
58 KERRANG!
Where I Go When
I Am Sleeping is
on the faces
+ ENDLESS HEIGHTS, RARITY written
of those gathered
vÀÌi wÀÃÌÃ
`
BOSTON MUSIC ROOM,
out night of their
LONDON
UK return. Some
sway with eyes
13/04/2018
closed, enveloped
in Fluorescents’
shoegazey swells.
Others yell until
they are hoarse, while others still are a blur as
they sail over the top of the crowd.
By comparison, openers Rarity are one big
expression of pleasant disbelief at the heartfelt
reception from tonight’s crowd, an entire
ocean away from their native Ontario. That is,
when the emo crew aren’t bouncing off the
Ü>
ÃÜÌ}V}viÀVÌÞ°iÃVi`}Ì
dreamier depths, Sydney’s Endless Heights are
less explosive, yet Come A Little Closer draws
everyone into their emotional undertow.
/ëÕëÕ
LiÌÜiiÃÌÀiÃÃ>`ÀiëÌi
rules Casey’s set. The echoing, funereal guitar
that welcomes Hell invokes foreboding, like
a ship drawn towards darkening clouds. Such
ÌiÃw`ÃÀi
i>Ãi>À`VÀi`i
Õ}iÃ
like Phosphenes, quickening the pulse and
squeezing air from lungs. Frontman Tom
CASEY
KKKK
The onstage wind
tunnel worked, then
Weaver, meanwhile, stands in the eye of this
storm. An unassuming man who appears
Õv>âi`>ÃL`iÃyÞ>ÀÕ`]Ã>Ûi vÀ>
sly grin of recognition when the crowd throw
his vulnerable words back at him. By the time
he retches out Ceremony, tonight feels like
an invitation to forget the world outside. But
truthfully, the world should take notice of
Casey. The moment feels right. J A M E S M A C K I N N O N
ANDREW W.K.
+ YONAKA
“Yes, we do get the
Mallory Knox channel…”
GREAT HALL, CARDIFF 13/04/2018
KKKKK
It’s party time as the man in
white crashes into Cardiff
Q “Never in my party dreams did
I ever imagine we’d still be partying
18 years into this.” As if Andrew W.K.
was ever going to stop. Boasting more
twitching muscularity and wide-eyed
abandon than closing-night at a powerlifting convention, the off-white knight
is simply unstoppable this evening.
First, though, Brighton alt.pop quartet
Yonaka come across a little less full-on.
There’s a slinking, shadowy panache to
tracks like Bubblegum, but they leave
a crowd just wanting to crush beers
and bang heads somewhat befuddled.
“We had to come to where the party
was extraordinarily hard,” announces
Ƃ`ÀiÜ7°°vÌÃwÀÃÌ1`>Ìi]>ÃÌi
he gets things back on track. “WALES!”
Cardiff on a Friday night is wild enough.
Powered by the power-positivity of
Music Is Worth Living For and You’re
Not Alone, it’s borderline unhinged.
And as She Is Beautiful and Party Hard
(counted in – from 100, obviously)
detonate, the Welsh capital descends
ÕÌÀ}ÌÌL>ÀiViÃÌi`]LiiÀy}}
madness. “That was a party force of
nearly paranormal intensity!” Mr W.K.
declares afterwards. We couldn’t have
put it better ourselves. S A M L A W
WINTERFYLLETH
ST PANCRAS OLD CHURCH, LONDON
13/04/2018
KKKKK
MALLORY
KNOX
+ DEAD!, JUDAS
British black metallers mellow
the folk out at acoustic show
THE HAUNT, BRIGHTON 16/04/2018
KKK
Q Black metal? In a church? With no
Rewired Brit rockers enjoy a cathartic
rebirth at first show as a quartet
Photo: ANDY GALLAGHER
Photos: CHRIS CASEY
wiÀÞÕÌiÀÀ
ÌÛi¶vÌ>ÌÃÕ`Ã
unusual, it’s because tonight isn’t
your usual gig. Having included folk
interludes on their albums for many
years now, Winterfylleth have done
away with electricity altogether and
made a record of entirely acoustic folk
material. The album, The Hallowing Of
Heirdom, is a genuine triumph, expertly
ÀiyiVÌ}ÌiÃÕ`Ãv`i}>`
so often referenced in the band’s lyrics,
and tonight, in this church – parts of
which date back to the fourth century
– the songs truly come to life. With the
quartet expanding to a seven-piece,
taking in keyboards, cello and a violin,
not to mention multi-harmony vocals,
The Wicker Man vibes of opener The
Shepherd and the mournful Latch To
A Grave transport you somewhere
genuinely shorn of modernity. Songs
are preceded by an explanation of the
folklore and history contained within the
lyrics – from ancient superstition about
spirits affecting crops to Lake District
chronicler Alfred Wainwright – which
adds to the atmosphere at odds with
the bustling city outside. It’s a brave
experiment, and one pulled off with
class, skill and mastery from one of the
most innovative and creative bands in
Ìi 1Õ`iÀ}ÀÕ`° N I C K R U S K E L L
Q This evening might just be the most
important show of Mallory Knox’s career.
Following the recent departure of singer
Mikey Chapman, tonight is bassist Sam
Õ}
>ýwÀÃÌÃvÌ>ÃÌi L>`½ÃiÜ
frontman. It’s no exaggeration to say that
it’s make or break time.
There’s no such pressure for the evening’s
supports. The only thing Judas are betraying
is an endearing enthusiasm for being here,
ÌÕ}ÌiÀÀ>`Ài>`ÞÌÕiÃ>ÛiÃÕvwViÌ
crossover appeal to suggest that their future
iÃÕVL}}iÀÃÌ>}iði>`t>Ài>
scrappier, if more entertaining, proposition.
While not every song in their set hits the
target, it’s not for want of piss and vinegar.
For Mallory Knox, choosing to open their
set with new single Black Holes is a clear
statement of intent, one that’s backed up
by the fact that it’s the best song they’ve
recorded to date. But while this and a couple
of other new tunes prove that they’re thinking
of the future, they’re also determined to
maintain the legacy they’ve already worked
Ã>À`ÌiÃÌ>L
ð/Ã`iw>Vi VÀi>ÌiÃ
a feedback loop with an audience who sing
along to Beggars and Lighthouse, clap in time
to Wired’s rhythms, and make The Haunt’s
yÀLÕViÌÃÌ/iÀÀÀ]Ìi
latter case literally voting with their feet.
Inevitably, losing a kinetic frontman like
Mikey affects the way the band go about their
business. “I still don’t know what the fuck
I’m doing,” jokes Sam towards the end of his
wÀÃÌ}ÌÌiL]LÕÌÞÕV>Ãii
}ÀÜVw`iViÌÀÕ}ÕÌÌiÀÃiÌ°i
doesn’t need to worry: on the strength of this
evening’s performance, Mallory Knox don’t
just have a future, but a bright one. O L L Y T H O M A S
Come on mate,
you don’t have to
hide like that…
KERRANG! 59
GET IN THE VAN
MOOSE
BLOOD
The Canterbury quartet operate
on the maxim, ‘Emo is a gang.’
And it looks like the gang’s gone
gloriously
g
loriously global
globa these days…
Photos: CHRIS SIMMS
60 KERRANG!
WHAT GOES
ON TOUR…
Guitarist MARK E.
OSBORNE lets us
in on the code…
The golden rule of touring
is… Keep the bus clean.
6JGƂTUVVJKPIYGFQYJGP
YGIGVVQCXGPWGKUe Find
the bathrooms and showers.
6JGQPGTKFGTGUUGPVKCNKUe
Peanut butter M&M’s.
Our dressing room music
of choice is… Phil Collins,
Michael Jackson, Boyz II Men
and Job For A Cowboy.
6JGQPGRJTCUG[QWoTG
NKMGN[VQJGCTQPTGRGCVKUe
‘Fucked it, mate.’ Usually in
relation to drinking too much.
The tour bus smells like…
It depends whose bunk you’re
near. Generally, it smells like
scented candles, aftershave
or old clothes.
6JGQPGVJKPIVJCVCPPQ[U
GXGT[QPGQPVQWTKUe
Mess and spilt food.
6JGUCFFGUVVJKPICDQWV
NGCXKPIVQWTVQIQJQOGKUe
We love going home. We miss
our homes and loved ones.
KERRANG! 61
GIG GUIDE
Bedford boys DON
BROCO are back from the
U.S. and ready for a UK
victory lap. Once they’ve
relearned their own songs…
Q&A ROB
DAMIANI
WORDS: james hingle
Photo: CHRIS CASEY
(VOCALS)
You’ve just come back from the U.S. –
how was your tour over there?
“It was insane! It’s amazing to see how
many people know the songs now.
"LÛÕÃ
ÞÌi wÀÃÌÌiÞÕ}ÕÌ]
>viÜ«i«
i>ÞÜ]LÕÌÞÕ½Ài
>Û}ÌÜÛiÀÌi VÀÜ`ð/Ã
ÌiÜi½`LÕ
ÌÕ«>LÌv>v>L>Ãi°
̽ÃÀi>
ÞiÝVÌ}LiV>ÕÃiÌÌ>iÃ
Ì}ÃL>VvÀÕÃq̽Ã>`vviÀiÌ
ÃVi>ÀÌÜ>̽Ã}}Ìi 1°
7i½Ài>LÀ>`iÜL>`ÛiÀÌiÀi]
ÜVÃÃÕ«iÀvÕ]LiV>ÕÃiÞÕ>Ûi
Ì>Ì`ÀÛi>`Õ}iÀvÀÜiÜi
ÜiÀi wÀÃÌ«
>Þ}ÃÜÃÌi 1°
9Õ½ÛiÀi>
Þ}ÌÌÜÛiÀ>VÀÜ`°»
Sounds good! So, what are the fans like
over there?
ºÛiÀÞiÃÛiÀÞ]ÛiÀÞV
°Ì½ÃÃ>À`
Ì}iÌÕÌÌÃÜÃÌi 1°-°LiV>ÕÃi
it’s just so L}°*i«
iÜ
`ÀÛi vÀ]
i]ÃiÛiÕÀÃÌÃiiÕÃqÌiÞÀi>
Þ
>iÌi ivvÀ̰̽ÃÀÀL
iÃiÌiÃ]
ÌÕ}]LiV>ÕÃiÜi½
LiÃÕ««ÀÌ}
>ÌiÀL>`>`ÃiiÜ
Vi
Õ«ÌÕÃ>`>ÃÕÃÜiÜi½Ài«
>Þ}]
>`ÜiÜÕ
`½Ûi>
Ài>`Þ«
>Þi`t̽Ã
>ÛiÀÞ`vviÀiÌ
>`ÃV>«iÕÌÌiÀi
ÌiÀÃv}i}À>«Þ°Ì>iÃÞÕ
>««ÀiV>ÌiÜ
ÕVÞÜi>ÀiÌi 1
62 KERRANG!
Ì>Ûi iÛiÀÞÌ}ÃV
ÃiÌ}iÌiÀ°
vÜi`>ÌÕÀÌi 1>`Üi«
>Þ
>ViÃÌiÀ]Ìi>ÕÌv>LÕÃiÜi
}iÌvÀ«i«
iÛiÀ«
LiV>ÕÃi
Üi½ÀiÌ«
>Þ}ÌiÀiÃÕÀÛ>
i`°
̽ÃVÀ>âÞqÞÕVÕ
`Õ«>ÌÀ>]Ì
ÜÕ
`Ì>iÞÕ>ÕÀÌ}iÌÌiÀit»
You were out there for your birthday,
so that must have been a lovely time?
º/i`>ÞLivÀiÞLÀÌ`>ÞÜi>`
>`>Þvv iÜ"À
i>Ã]ÜVÃ
“PEOPLE IN AMERICA
WILL DRIVE SEVEN
HOURS TO SEE US…”
R O B
D A M I A N I
«ÀL>L
ÞivÞv>ÛÕÀÌi«
>ViÃ
čiÀV>°Ì½ÃÌÃÃ>ÃvčiÀV>
VÕ
ÌÕÀi VLi`ÜÌÀiV>`
-«>ÃyÕiViÃq̽Ã>Ü
ii
Ì}
«Ìv`ÛiÀÃÌÞ°/iÀi½Ã>
ÌiÃiVi
ÕÃiÕÃ>`>ÌμÕiëÃ]LÕÌv
ÞÕ}iÃÌÀiiÌ>
}ÞÕ½Ûi}Ì>
ÃÌÀiiÌvÃÆÜÌVVÌ>
L>ÀÃ]ÃÌÀ«
V
ÕLÃ>`«i«
iÕÃÌÕÌvÌiÀ`
`ÀÕÌi``
ivÌi`>Þ°7iÜiÌ
ÌÌÃ>Þ*À`i«>À>`i>`ÃÌ>ÀÌi`
`À}>LÕÌ``>Þ°7i vÀVi`
iÛiÀÞiÌÃÌ>ÞÕÌ>ÃÞLÀÌ`>Þ
Ü>ýÌÕÌ
Ìi`}Ì]>`>ÃÃ
>ÃÌi V
VÃÌÀÕV`}Ì]ÜiÜiÀi
i]¼,}Ì]̽ÃÌiÌ}Ü]½>ÃÜi
ÜiÀi>ViÀi`vÀ>`>Þv`À}
ÌiÃÕt»
Let’s talk UK. Can we expect to get a
Technology-heavy set?
º9iÃt7i½Ài VÕÀÀiÌ
ÞÀi
i>À}>
>`
viÜÃ}ð7iÜiÀi>``}iÜ
Ã}Ã`ÕÀ}Ìi
>ÃÌÌÕÀ>ÃÜiÜiÌ
>
}]ÃÜi½ÀiÀi
i>À}ÃivÌi
iÜiÃLiV>ÕÃiÌiÀi½ÃÃiÜi
>Ûi½Ì«
>Þi`ÃViÜiÀiVÀ`i`Ìi°
ÀÌÃÌÕÀÜiÜ>ÌÌ>``>
>`
viÜiÃÃÌ
]ÃÜi½ÛiÀi
i>Ài`
/i
ÕiÃ>`-iÌ}/À]
Ìii«ÌvÀiÃ>`iÝVÌ}vÀÕð
We want to play the new album to
«i«
iÜ>ÞLi>Ûi½Ìi>À`ÕÃ
«
>Þ}ÌÃiiÜÃ}ÃLivÀi°»
Can we expect you to do your Linkin
Park/N.E.R.D mash-up cover again?
º9i>]Üi``Ì>Ì>viÜÌiÃ
Ìi
>ÃÌÌÕÀ°/iÀiÜ>ÃiÃÜ
ÜiÀiÜiÜiÀi}}vÀ«ââ>]>`
Ãii V>iÕ«ÌÕÃ>Ã}v
ÜiÜÕ
`«
>Þ̰̽Ã>
Ü>ÞÃvÕÌ
`Ì>ÌÃÌÕvv]>ÃÜiiÛiÀÀi>
Þ`
VÛiÀð̽ÃViÌÝÌ}ÃÕ«>`
ÌÀÞÌÕÌ°č}>]Üi>Ûi½Ì`i
Ì>ÌÃViÌi Li}}vÌiÞi>À]
LÕÌv«i«
iÜ>ÌÌi>ÀÌ>ÌL>`
Þ]
ÌiÞii`Ì«ÕÌÕ«>}`>À}ÕiÌ
>`Üi}ÌÃÕÀ«ÀÃiÞÕ°»
DATES
OXFORD O2 Academy
April 26,
SHEFFIELD O2 Academy
27,
LIVERPOOL O2 Academy
28,
LINCOLN Engine Shed 29,
STOKE Keele University
May 1,
NORTHAMPTON
Roadmender 2,
EXETER Lemon Grove 3.
Support:The Lafontaines,
Yungblud.
NO
BOO G
Our Home, Napoleon, Kingdom Of Giants, Invisions,
Death Remains, Skarlett Riot, Ravenface, Veridian,
Chapter & Verse, Bellevue Days, Black Orchid Empire,
Tenements, Silent Screams, Siamese, Falling Red,
Palm Reader, Wars, Cove, Woke Up Dead, Bury The
Traitor, Kill The Ideal, Deadaudiosaints, 76 Calling.
York Fibbers June 22 – 23.
3 = JUST
JUS ANNOUNCED
OU C
Ramblin’ Man Fair Line-up: Halestorm, Blackberry
Queens Of The Stone Age London Finsbury Park
June 30. Support: Iggy Pop, The Hives, Run The
Jewels, Brody Dalle.
Smoke, Sons Of Apollo, Steve Earle And The Dukes,
Steel Panther, The Cult, Therapy?, Mott The Hoople, Me
And That Man, The Cadillac Three, Tyler Bryant And The
Shakedown. Maidstone Mote Park June 30 – July 1.
2000Trees Festival Line-up: Enter Shikari, At The
Drive In, Basement, Arcane Roots, Creeper, Hell Is For
Heroes, Touché Amoré, Turbowolf, Gold Key, Black
Foxxes, Boston Manor, Conjurer, SHVPES, Loathe,
Chapter And Verse, Holding Absence, Holiday Oscar,
Ho99o9, The Xcerts, Black Peaks, Hellions, Dream
State, Sløtface, Press to MECO, Fangclub, Gallops,
Nervus, Black Futures, GenderRoles, Bitch Falcon,
Lady Bird, Sun Arcana, Haggard Cat, Sean McGowan,
Frightened Rabbit, Blood Red Shoes, And So I Watch
You From Afar, My Vitriol, Black Honey, Queen
Kwong, VUKOVI, Blood Command, DEAD!, Brutus,
Funeral Shakes, Nova Twins, Bloody Knees, Gloo,
Muskets, P D Liddle, No Violet, Phoxjaw, Warshy,
Sœur. Cheltenham Upcote Farm July 12 – 14.
Reading & Leeds Festival Line-up: Fall Out Boy,
Panic! At The Disco, Nothing But Thieves, Wolf Alice,
Papa Roach, UNDERØATH, Waterparks, Creeper, Sum
41, Beartooth, Nothing,Nowhere, Hollywood Undead,
Slaves, Don Broco, Billy Talent, Deaf Havana, Milk
Teeth, Mike Shinoda, Skindred, Trash Boat, Dinosaur
Pile-Up, The Used, The Xcerts, The Faim, Black Peaks,
Blood Youth, SHVPES, Man With A Mission, Ecca
Vandal, Normandie, Sleep Token, Death From Above,
Royal Republic.. Reading Richfield Avenue and Leeds
Bramham Park August 24 – 26.
A Perfect Circle O2 Apollo Manchester June 12,
BULLET FOR MY VALENTINE
London O2 Academy Brixton 13, Manchester Victoria
Warehouse December 3, London SSE Arena Wembley 5
ALICE IN CHAINS O2 Academy Leeds June 16,
London O2 Shepherd’s Bush Empire 17.
Dates: London Alexandra Palace November 10, Cardiff Motorpoint Arena 11.
Support: Of Mice & Men.
American Nightmare London Camden
Underworld April 28, Brighton Haunt 29.
Arctangent Line-up: And So I Watch You From
Afar, Pianos Become The Teeth, Foxing, Giraffes?
Giraffes!, Jamie Lenman, Rolo Tomassi, Alpha Male
Tea Party, Talons, Tangled Hair, Svalbard, Gulfer,
Body Hound, Glassjaw, Shellac, La Dispute, Arcane
Roots, Alcest, Zeal & Ardor, Black Peaks, VENNART,
Delta Sleep, Telepathy, People Like Milk Products
(Memory Of Elephants & Chiyoda Ku Big Band),
Scalping, Wren, Jo Quail, VLMV, Vasquez, Mouse On
The Keys, Plini, Tides Of Man, OHHMS, Poly-Math,
Jean Jean, Pijn & Conjurer, Conjurer, Blueneck, Boss
Keloid, Mol, Orchards, Halo Tora, Bad Sign, Natalie
Evans, Death And The Penguin, Coldbones,Black
Futures, Seven Colour Drive, Codices, Only Echoes
Remain. Bristol Fernhill Farm August 16 – 18.
As It Is Norwich Arts Centre May 21, Sheffield Plug
22, Bristol Lantern 24, London St Pancras Old Church
25. Support: Dream State.
August Burns red Birmingham O2 Institute
December 8, Manchester Club Academy 9, Glasgow
Garage 11, Bristol Fleece 12, London O2 Academy
Islington 13.
3BIFFY CLYRO
Dublin Helix September 15,
Belfast Waterfront 16, Cardiff St. David’s Hall
18, Birmingham Symphony Hall 19, Edinburgh Usher
Hall 21, Manchester Opera House 22, London Royal
Albert Hall 24.
BLACK PEAKS St Albans Horn May 1, Aldershot West
End Centre 2, Bath Moles 3.
Bloodstock Festival Line-up: Judas Priest,
Gojira, Nightwish, Emperor, DevilDriver, Watain,
Orden Ogan, Fozzy, Combichrist, Memoriam,
Septicflesh, Doro, Bloodbath, Cannibal Corpse, At The
Gates, Kamelot, Mr. Big, Alestorm, Suicidal Tendencies,
Venom Inc., Jasta, Wednesday 13, Amaranthe,
Orphaned Land, Doro, Bleed From Within, Exhorder,
Ingested, Mantar, Pallbearer, Vola, Sangre, Dead
Label, Doomsday Outlow, Underside, King Leviathan,
Fahran. Derby Catton Hall Park August 9 – 12.
Body Count London KOKO Camden June 12.
Support: Astroid Boys, Crisix.
Boomtown Festival Line-up: Limp Bizkit, Enter
Shikari, Napalm Death, Soulfly, Capdown, Idles,
Ho99o9, Earth Crisis, Hacktivist, Turbowolf, Sonic
Boom Six, Voodoo Glow Skulls, Random Hand,
Adolescents, Jaya The Cat, The Rumjacks, Inner
Terrestrials, Moscow Death Brigade, Samsara Blues
Experiment, Haggard Cat, [Spunge]. Winchester
Matterley Estate August 9 – 12.
The Bronx Manchester Gorilla June 8, London
Camden Electric Ballroom 10. Support: Culture Abuse.
Camden Rocks Festival Line-up: Twin Atlantic,
PiL, Beatsteaks, Raging Speedhorn, Sonic Boom Six, The
Red Paintings, SHVPES, Ducking Punches, Carcer City,
Press to MECO, Gold Key, Skarlett Riot, Death Remains
and more! Camden @ various venues June 2.
Cancer Bats London Camden Underworld April
26 – 28.
CLUTCH O2 Academy Bristol December 18, O2
Academy Glasgow 19, Manchester Academy 20,
London O2 Brixton Academy 21, O2 Academy
Birmingham 22.
Converge Manchester Academy II April 25, London
Camden Electric Ballroom 26. Support: Crowbar,
Thou, Grave Pleasures.
Danzig Glasgow Barrowlands August 6, London O2
Academy Brixton 7.
3
DEAD! London Camden Underworld
October 5.
Dead Swans Glasgow Audio May 10, Manchester
Deaf Institute 11, Bristol Louisiana 12, London
Camden Assembly 13.
Ded London Black Heart Camden June 11. Support:
Death Blooms
Def Leppard Cardiff Motorpoint Arena December
4, London O2 Arena 6, Nottingham Motorpoint
Arena 8, Metro Radio Arena 9, Glasgow SSE Hydro
11, Manchester Arena 12, Sheffield FlyDSA Arena
14, Liverpool Echo Arena 15, Birmingham Arena 17.
Support: Cheap Trick.
Desertfest Line-up: Monster Magnet, Nebula,
Eyehategod, Hawkwind,Jex Thoth, Planet Of Zeus, Black
Moth, The Black Wizards, Graveyard, Napalm Death,
Warning, Winterfylleth, Five The Hierophant and more!
London Camden May 4 – 6 @ various venues.
Don Broco O2 Academy Oxford 26, O2 Academy
Sheffield 27, O2 Academy Liverpool 28, Lincoln
Engine Shed 29, Stoke Keele University May 1,
Northampton Roadmender 2, Exeter Lemon Grove 3.
Download Festival Line-up: Ozzy Osbourne,
Avenged Sevenfold, Guns N’ Roses, Marilyn Manson,
BABYMETAL, Asking Alexandria, Black Veil Brides,
Alexisonfire, Bullet For My Valentine, Rise Against,
Parkway Drive, Body Count, The Hives, In This
Moment, Neck Deep, Meshuggah, Mayday Parade,
The Pink Slips, WSTR, Dream State, Black Stone
Cherry, Boston Manor, Cradle Of Filth, DragonForce,
Hatebreed, Inglorious, Marmozets, Monster Truck,
Shinedown, The Struts, The Temperance Movement,
Thunder, Volbeat, Whiskey Myers, Bury Tomorrow,
Corrosion Of Conformity, Dead Cross, Jonathan Davis,
Kreator, L7, Powerflo, Thrice, Turbonegro, You Me At
Six, Cancer Bats, Employed To Serve, Jamie Lenman,
Milk Teeth, Puppy, Stick To Your Guns, Stray From
The Path, The Bottom Line, The Bronx, The Faim,
The Maine, All Them Witches, Baroness, blessthefall,
Death Blooms, Emmure, Gold Key, Higher Power,
Knocked Loose, Koyo, Malevolence, Miss May I,
Myrkur, No Hot Ashes, Plini, Rolo Tomassi, SHVPES,
Sun Arcana, Tesseract, The Hyena Kill, Thy Art Is
Murder, Tigress, Wayward Sons, Zeal & Ardor, Avatar,
Hell Is For Heroes, Andrew W.K., CKY, Nothing More,
Culture Abuse, Lawnmower Deth, Starcrawler, Bad
Religion, Ded, Being As An Ocean, A, Black Foxxes,
Bad Cop/Bad Cop, Igorr, Loathe, Kaiser Franz Josef,
Helpless, Cellar Darling, Anchor Lane, Ecca Vandal.
Derby Donington Park June 8 – 10.
Nottingham Rock City 18, O2 Institute Birmingham
19, Cardiff St. David’s Hall 21, Portsmouth Pyramids
Centre 22, London Royal Albert Hall 23, Brighton
Dome 24. Support: King King.
Birmingham O2 Institute 9, O2 Academy Bristol
10, Southampton Guildhall 11, Cambridge Corn
Exchange 13, Norwich UEA 14, O2 Academy Oxford
16, London Roundhouse Camden 17.
EVERY TIME I DIE London Garage May 29.
Foo Fighters Manchester Etihad Stadium June 19,
Lower Than Atlantis O2 Academy Oxford May
London Stadium 22 – 23. Support: Wolf Alice (19
and 22 only), Frank Carter & The Rattlesnakes (22
only), The Kills (23 only), Slaves (23 only).
Frank Turner & The Sleeping Souls O2
Academy Liverpool April 25, O2 Academy Bristol 27,
Exeter Uni Great Hall 28, Cambridge Corn Exchange
30, O2 Guildhall Southampton May 1, Southend Cliffs
Pavilion 2, O2 Academy Leicester 4, O2 Academy
Oxford 5, Hull City Hall 8, Norwich UEA 9.
The Gaslight Anthem London Eventim Apollo
Hammersmith July 20 – 21, Dublin Vicar Street 23,
Glasgow Barrowland 24, Manchester Eventim Apollo
25. Support: The Flatliners, Matthew Ryan.
Glassjaw London O2 Academy Brixton August 18.
HALESTORM Dublin Academy September 19, Belfast
Limelight 20, O2 Academy Sheffield 22, O2 Academy
Glasgow 23, O2 Academy Birmingham 24, O2 Apollo
Manchester 26, London O2 Academy Brixton 28, O2
Academy Bristol 29.
HEART OF A COWARD London Boston Music Room
May 30, Manchester Rebellion June 1.
Heavy Scotland Line-up: Carcass, Gama Bomb,
Nervosa, Perpetua. Edinburgh Corn Exchange August
31 – September 2.
3Hellions
London Old Blue Last July 11,
Birmingham Sunflower Lounge 12, Milton
Keynes Craufurd Arms 14, Bournemouth The Anvil
15, Dover Booking Hall 17, Bristol Hy Brasil 18,
Newport Le Pub 19, Guildford Boileroom 21, Norwich
Waterfront Studio 23, Huddersfield The Parish 24,
Glasgow The Garage 25, Newcastle The Think Tank
26, London Birthdays 28. Support: Chapter And Verse
HO99O9 Bristol Exchange May 24, Leeds Brudenell
Social Club 25, Manchester Soup Kitchen 26, London
Lexington 27.
Hollywood Vampires Birmingham Genting
Arena June 16, Manchester Arena 17, Glasgow SSE
Hydro 19, London SSE Arena, Wembley 20. Support:
The Darkness, The Damned.
Iron Maiden Newcastle Metro Radio Arena July 31,
Belfast SSE Arena August 2, Aberdeen AECC BHGE Arena
4, Manchester Arena 6, Birmingham Genting Arena 7,
London O2 Arena 10. Support: Killswitch Engage.
Jonathan Davis Manchester Club Academy
June 6, London O2 Academy Islington 7.
KARMA TO BURN London Camden Black Heart June
3, Reading Sub89 4, Wrexham Central Station 5,
Liverpool Hangar34 7, Aberdeen Lemon Tree 8,
Edinburgh Liquid Rooms 9, Middlesbrough Empire
11, Hull Welly 12, York Fibbers 13, Sheffield Plug 14.
Support: Boston Manor (May 3 – 14), The Faim.
Machine Head O2 Guildhall Southampton May
13, Cardiff University 14, O2 Academy Bristol 15,
O2 Academy Birmingham 17, London Camden
Roundhouse 18 – 19, Nottingham Rock City 21, O2
Academy Newcastle 22, O2 Academy Glasgow 23,
Manchester Academy 25.
THE MAINE London Camden Dingwalls June 6,
Manchester Deaf Institute 7.
MARMOZETS Norwich Waterfront May 4, O2
Academy Liverpool 5, Newcastle Boiler Shop Hit
The North Festival 6, Exeter Lemon Grove 7,
Northampton Roadmenders 9, Coventry Kasbah 10,
O2 Academy Oxford 11. London O2 Forum Kentish
Town October 19. Support: Black Peaks.
Leeds 27, London O2 Academy Brixton 28, O2 Institute
Birmingham 29. Support: CKY, Danko Jones.
Slam Dunk Festival Line-up: Jimmy Eat
World, Taking Back Sunday, Sleeping With Sirens,
State Champs, Four Year Strong, Trash Boat, Good
Charlotte, PVRIS, Frank Carter & The Rattlesnakes,
Thursday, Creeper, Every Time I Die, Knuckle Puck,
Real Friends, Crown The Empire, Zebrahead, The
Audition, Goldfinger, The Skints, Twin Atlantic,
Northlane, Trash Boat, ROAM, Broadside, Can’t Swim,
Capdown, Comeback Kid, Counterparts, Save Ferris,
Set Your Goals, Real Friends, Lower Than Atlantis, Say
Anything, Homesafe, Me Vs. Hero. Leeds City Centre
May 26, Hatfield Park 27, Birmingham NEC Arena 28.
STAND ATLANTIC London Camden Assembly May 25.
Stone Free Festival Line-up: Megadeth, Scorpions,
Yes, Roger Hodgson, Orange Goblin Joanne Shaw
Taylor, Buckcherry. London O2 Arena June 16 – 17.
Stone Sour Manchester O2 Apollo June 17, London
Camden Roundhouse 18, Nottingham Rock City 19.
Svalbard London Camden Black Heart May 24,
Tech Fest Line-up: The Acacia Strain, The
Modern Life Is War Brighton Haunt June 25,
Contortionist, Cyclamen, Amogh Symphony, Vola,
DVSR, Jinjer, Tides From Nebula, Voyager, Bloodshot
Dawn, Rishabh Seen, The Surrealist, Damned Spring
Fragrantia, Chris Schiermann, Siamese, Stomb, Leeched,
You Win Again Gravity, SikTh, Protest The Hero,
Conjurer, Norma Jean. Newark Showground July 5 – 9.
Leeds Brudenell Social Club 26, Bristol Exchange 27,
London Camden Underworld 28.
Movements Leicester Cookie April 30, Newcastle
Think Tank? May 1, Glasgow King Tut’s 2, Leeds Key
Club 4, Manchester Night People 5, Birmingham
Asylum 6, Cardiff Clwb Ifor Bach 7, Brighton Sticky
Mike’s Frog Bar 8, London Camden Assembly 9.
Nickelback Glasgow SSE Hydro May 3, Leeds First
Direct Arena 5, Liverpool Echo Arena 7, Manchester
Arena 8, Birmingham Genting Arena 10, London
O2 Arena 11, Nottingham Motorpoint Arena 13.
Support: Seether.
Nightwish London SSE Arena Wembley December
8, Birmingham Arena 10, Manchester Arena 11.
Support: Beast In Black.
Novelists London Boston Music Room May 1,
Glasgow Garage Attic 2, Birmingham Asylum II 3,
Manchester Rebellion 4, Sheffield Mulberry Bar 5.
Support: Landmvrks.
Of Mice & Men O2 Institute Birmingham April 25,
Norwich UEA 26, London Camden KOKO 27. Support:
Wage War, Sylar.
Outbreak Fest Line-up: Code Orange, Turnstile,
Cro-Mags, Floorpunch, Angel Dust, Fury, Jesus Piece, Big
Cheese, Servitude. Leeds Canal Mills June 16 – 17.
Southampton Joiners August 10
Killing Joke Nottingham Rock City November
Europe Manchester Academy September 14,
2, O2 Academy Leeds 3, Newcastle University 4,
Glasgow Barrowland 6, Manchester Academy 7,
Pearl Jam London O2 Arena June 18 – 19.
Pile Up Festival Line-up: A Wilhelm Scream,
Glasgow Barrowland 15, O2 Academy Newcastle 17,
Skindred O2 Academy Bristol April 25, O2 Academy
Deftones, Placebo, My Bloody Valentine, Mogwai,
65daysofstatic, Alcest, MONO. London Southbank
Centre June 15 – 24.
Enter Shikari Hatfield Forum July 13,
3
Manchester Academy May 4, Birmingham Digbeth
Arena 5, London Eventim Apollo Hammersmith 6, O2
Academy Glasgow 19, O2 Academy Newcastle 20.
3The Struts
3PALLBEARER
Leicester Cookie 17, Huddersfield Parish 18, Cardiff
Clwb Ifor Bach 19. Support: Conjurer, God Complex.
Reef / The Wildhearts / Terrorvision
MELTDOWN FESTIVAL Line-up: Nine Inch Nails,
18, Exeter Cavern 19, Bristol Exchange 20, Coventry
Phoenix 21, Manchester Rebellion 22, Newcastle Think
Tank? 23, Glasgow Cathouse 24, Leeds Temple Of Boom
25, Milton Keynes Craufurd Arms 26, Oxford Cellar 27,
Bournemouth Anvil 28. Support: Desert Storm.
Employed to serve Norwich Waterfront May 16,
REBeLLION FESTIVAL Line-up: Public Image
Limited, The Menzingers, The Vandals, Buzzcocks,
Stiff Little Fingers, Discharge, The Exploited, Ruts DC,
Lagwagon, UK Subs, The Adolescents, Raw Power,
Toxic Reasons, DRI and many more! Blackpool Winter
Gardens August 2 – 5.
London Islington Assembly Hall
July 16, Glasgow Stereo 17, Leeds Brudenell
Social Club 18, Bristol The Fleece 19.
Oceans Ate Alaska, Teenage Bottlerocket, Our Hollow,
London Camden KOKO June
18, Manchester Gorilla 20.
Nottingham Soan 25. Support: MØL, Group Of Man.
Thrice London Electric Ballroom Camden June 9.
Touch Down festival Line-up: Mallory Knox,
Jolan, Homebound, Seek Solace In Ruin, Wolfpeake,
Northshore, Winter Band, Dalzell, Ivory Veins.
Workington Jane Street July 14.
Touche Amore Portsmouth Wedgewood Rooms
July 10, London Dome 11,Nottingham Rescue Rooms
12. Support: Gender Roles.
Tremonti O2 ABC Glasgow June 28, London O2
Shepherd’s Bush Empire 29, O2 Institute Birmingham
30, Belfast Limelight July 2, Dublin Academy 3,
Portsmouth Pyramids 5.
TWIN ATLANTIC Newcastle Riverside May 24,
Norwich Waterfront 30, Southampton Engine Rooms
June 1, Cardiff Tramshed 3. Support: Bellevue Days.
WEDNESDAY 13 Dublin Tivoli August 7,
Belfast Limelight 8, Glasgow Garage 9.
Within Temptation O2 Academy Birmingham
November 9, O2 Apollo Manchester 10, O2 Academy
Glasgow 11, London O2 Academy Brixton 13.
WOES Birmingham Flapper May 2, Cardiff Clwb
Ifor Bach 3, Liverpool Sound Basement 5,
Norwich Waterfront Studio 6, Newcastle Jumpin
Jacks 7, Edinburgh Opium June 21, Inverness Tooth
& Claw 22, Dundee Beat Generator 23, Glasgow
Garage Attic 24.
KERRANG! 63
new album
‘pray for the wicked’
WIDE RANGE
OF EXCLUSIVE PRODUCTS
new album
‘reverence’
VINYL
LIMITED
EDITION
Impericon.co.uk
SMALL ADS
OVER 250,000 ITEMS FROM
YOUR FAVORITE BANDS
9VJRHIPSPHJVTVMMLYZ[OLSHYNLZ[ZLSLJ[PVUVMT\ZPJTLYJOHUKPZL`V\^PSSÄUKVU[OL>LIWLYPVK
For a free catalog, visit rockabilia.com, call or write: 76)V_ +LW[ *OHUOHZZLU45<:(
JUST SOME OF THE MANY
PLAYLISTS ON THE
SPOTIFY
@KERRANGMAGAZINE
To advertise call: Daisy Perkins on 0207 078 8429 e.mail daisy@wastedtalent.com
NEXT WEEK
T: 0 2 07 078 8429
E: FEE D BACK @K E RRAN G.COM
W : K ERRAN G.C O M
E DI TO RI AL
E M A IL : FI RST. L AST N AM E@ K ERRA NG.C O M
EDITOR
Sam Coare
ART EDITOR
Steve Beech
SENIOR EDITOR
Nick Ruskell
ASSOCIATE EDITOR
David McLaughlin
DEPUTY ART EDITOR
Matt Dykzeul
NEWS EDITOR
Emily Carter
PRODUCTION EDITOR
Tom Shepherd
DIGITAL EDITOR
Bob Foster
LISTINGS EDITOR
James Hingle
CONTRIBUTING EDITORS
Katie Parsons, Jennyfer J. Walker
CONTRIBUTORS
Matt Allen, Alex Baker, Steve Beebee, Paul Brannigan,
Daniel P. Carter, Hannah Ewens, George Garner, Stu
Garneys, James Hickie, Justine Jones, Sam Law, Alistair
Lawrence, John Longbottom, James MacKinnon, Mischa
Pearlman, Jake Richardson, Amit Sharma, Dan Slessor,
Mark Sutherland, Olly Thomas, Ben Tipple, Paul Travers,
Ian Winwood, Rod Yates, Simon Young, Ray Zell.
PHOTOGRAPHERS
Tom Barnes, David Bergman, Lindsey Byrnes, Chris
Casey, Ian Collins, Carrie Davenport, Andy Ford, Andy
Gallagher, Paul Harries, Jeremy Harris, Lisa Johnson,
Andrew Lipovsky, Ashley Maile, Tom Martin,
Perou, Martin Philbey, Andrew Timms,
Neil Visel, Dave Willis.
VI PS
TOMORROW’S
HEADLINES, TODAY!
Theresa May
announces
surprise
link-up with
Ghost for
‘Brexit
Means Brexit’
UK tour
A DVE RT I SI N G
TE L EPH ON E: 0207 078 8423
BUSINESS DEVELOPMENT MANAGER
Juliette Roques
(juliette.roques@wastedtalent.com)
ADVERTISING SALES MANAGER
Owain Harries (owain@wastedtalent.com)
DIGITAL SALES MANAGER
Katie Scrafton (katie@wastedtalent.com)
ADVERTISING PRODUCTION
Daisy Perkins (daisy@wastedtalent.com)
S U B SC RI PT I O NS
Kerrang.imbmsubscriptions.com
01293 312 213 / (+44) 01293 312 213
BAC K I SSUES
words: simon young
CEO
Jerry Perkins (jerry@wastedtalent.com)
GLOBAL CREATIVE DIRECTOR
Phil Alexander (phil.alexander@kerrang.com)
M.D.
Nick Stevenson (nick@wastedtalent.com)
EXECUTIVE DIRECTOR, U.S.
Ethan Fixell (ethan@kerrang.com)
FINANCIAL DIRECTOR
David Joseph
DIRECTOR
David Hepworth
CHAIRMAN
Ian Flooks
DISTRIBUTION Seymour (0207 429 4000)
PRINTING PCP
Marilyn Manson says home
decorating has its challenges,
but guest room looks “lovely”
Escaped mouse ruins Rammstein
reunion dinner party,
spokesperson confirms
INK, PAPER, AND THE GREATEST INTERVIEWS, REVIEWS AND MORE
IN NEXT WEEK’S KERRANG!,
ON SALE MAY 2
Newsstand.co.uk/kerrang
Kerrang! ISSN 0262-6624 is published 51 times a
year by Wasted Talent Ltd, a company registered in
England and Wales with company number 4333049.
90 – 92 Pentonville Road, London, N1 9HS
SAY G’DAY TO YOUR EXCLUSIVE
PARKWAY DRIVE ART PRINT!
TTO CELEBRATE PARKWAY DRIVE’S RETURN TO THE K! COVER WITH
NEW
W ALBUM REVERENCE, WE’VE TEAMED UP WITH THE BAND TO BRING
YOU THIS EXCLUSIVE, NEVER-BEFORE-SEEN ART PRINT!
Illustration: Kentaro Yoshida
Документ
Категория
Журналы и газеты
Просмотров
10
Размер файла
31 832 Кб
Теги
journal, Kerrang!
1/--страниц
Пожаловаться на содержимое документа