close

Вход

Забыли?

вход по аккаунту

?

Living Edge - May 2018

код для вставкиСкачать
WELCOME
HOOR0D\3OHDVHSOHDVHOHW
WKLVPRQWKGHOLYHUWKH
VXQVKLQHDQGZDUPWKZHDOO
FUDYH:HKDGDEULHIEXUVWRI
WKHJRRGVWXIIODVWPRQWKZKLFKZKLOH
GHOLJKWIXOVHUYHGWRPDNHPHHYHQPRUH
DQ[LRXVIRUDVXQILOOHGVXPPHU,W¶VDOOLQ
WKHODSRIWKHJRGVKRZHYHUVREHVWWREHDOO
%ULWLVKDERXWLWDQGJULWRXUWHHWKDQGFDUU\
RQUHJDUGOHVVRIZKDWWKHVNLHVEULQJ
0DNHSODQVIRUVXQUHODWHGIXQDQG
SDFNDFDJRXOHKHUHDWKRPH±ZK\QRW
HQWHURXUIDEXORXV5HZLQGFRPSHWLWLRQRQ
SDJH",IVLWWLQJRQDFDPSFKDLULQD
ILHOGZLWKRWKHUSHRSOHLVQ¶W\RXU
EDJWKHQHQWHURXUVW\OLVK$IWHUQRRQ7HD
FRPSHWLWLRQLQVWHDGIRXQGRQSDJH,
VKDOOEHSDUWDNLQJRIERWKGHOLJKWVWKLV
VXPPHU,ORYH5HZLQGDQGWKHIDFWWKDWLW¶V
KHOGKHUHLQ&KHVKLUHILOOVPHZLWKMR\DQG
ZKRGRHVQ¶WORYHDKRWFXSSDDQGDIUHVK
LIVING EDGE
Archant Community Media Ltd
+
The Barn, Hobb Lane, Daresbury
Warrington, WA4 5LS. Tel: 01925 438 121
Advertisements & Sales: 07918 696074
Editorial: editorial@livingedgemag.co.uk
Don’t forget, you can
read Living Edge online. Visit:
livingedge.co.uk
Editor Kate Houghton
kate.houghton@archant.co.uk
Advertisement Sales Manager
Claire Cooper
07918 696074
claire.cooper@archant.co.uk
VFRQH"-DPWKHQFUHDPRUFUHDPWKHQ
MDP«OHW¶VQRWDUJXH
+DYHDVPDVKLQJPRQWK
.DWH[
.DWH+RXJKWRQ(GLWRU
Commercial Director (North): Rhiannon Wragg
07866 544997
rhiannon.wragg@archant.co.uk
Property Sales Executive Lesley Turner
lesley.turner@archant.co.uk
Sales Administration Linda Chase
Production Assistant Jane Ramsay
jane.ramsay@archant.co.uk
National Sales Richard Evans
07501 481711
richard.evans@archant.co.uk
National Sales: Mediaforce
archant@mediaforce.co.uk
COVER IMAGE:
Summer’s coming
© heckmannoleg /
iStock / Thinkstock
Regional Retail Circulation Manager
Richard Shevlin 07970 047024,
richard.shevlin@archant.co.uk
Group Editor Roger Borrell
roger.borrell@archant.co.uk
Publishing Director Rhiannon Wragg
Executive Director, Magazines
Peter Timperley, 01242 216062
peter.timperley@archant.co.uk
C ON TENTS
ENTERTAINMENT
BEAUTY
9 Upfront
10 What’s On – May
20 WIN! Weekend tickets to
Rewind North!
66 Lauren Simon’s super-fix
75 May’s must-haves
PEOPLE & PLACES
FASHION
72 Leading the way
6 Ester Dee
30 Seema Malhotra
49 Altrincham
HOME & GARDEN
SUMMER
PROPERTY
57 WIN! Afternoon Tea in Knutsford
60 Bring me sunshine
64 Dress up
95 Hearts and homes
39 Mid-century style
44 Artful dodgers
SCHOOLS
82 Building a future
4
livingedge.co.uk
Designer Sophie Maloney
Living Edge is published by Archant Community Media
Limited (company number 19300) and printed by
William Gibbons. Archant Community Media Limited
is a leading family-owned community media company
based at Prospect House, Rouen Road Norwich NR1
1RE. The Company is active in the fields of
newspaper and magazine publishing, contracting
printing, marketing, internet communications and
television.
Reproduction of any material, in whole or in part, is
strictly forbidden without the prior written consent of
the publisher. All material is sent at the owner’s risk
and, while every care is taken, Archant Community
Media Limited will not accept liability for loss or
damage.
Cheshire Life journalists are committed to abiding
by the Society of Editors’ Code of Practice. If you have
a complaint which cannot be resolved by Living Edge
editor Kate Houghton at kate.houghton@archant.co.uk
please contact the Independent Press Standards
Organisation (IPSO), c/o Halton House, 20-23 Holborn,
London, EC1 2JD, or via complaints@ipso.co.uk.
More information about IPSO and its regulations can
be found at www.ipso.co.uk.
Competition rules and full terms & conditions
are available at www.livingedge.co.uk
The Duke & Duchess of Devonshire @ Chatsworth
0D\
PLANT HUNTERS’
FAIR @ ADLINGTON
HALL
Plant Hunters’ Fairs return to Adlington Hall
for what has become one of the best
loved garden events in the area with a
winning line up of the best nurseries
around.
planthuntersfairs.co.uk
-XQH
CHESHIRE
LUXURY SHOW
The first ever Cheshire Luxury Show
arrives The Mere Golf and Spa Resort in
Knutsford. Celebrating exuberance and
indulgence, the exclusive invite-only event
will showcase the peak of aspirational
products and companies refined in luxury.
Over 45 exhibitors offering very select
products, a running order of key influential
speakers from some of Cheshire’s finest
businesses and carefully selected
entertainment. The Show supports
Caudwell Children, a charity that is
dedicated to the lives of children with
disabilities.
To register your interest in attending this
event, visit cheshire.theluxuryshow.co.uk
±0D\
THE FRENCH
PROPERTY EXHIBITION
Held at Wetherby Racecourse, with free
seminars offering expert advice on all aspects
of the buying process and thousands of
properties to browse from, this is a one-stop
shop for anyone interested in purchasing
property in France.
frenchpropertyexhibition.com
SIMPLY CHESHIRE
20 – 21 May
With over 80 talented, carefully selected
exhibitors showcasing the county’s best
makers, designers and producers, it’s
the perfect way to spend a day out. You
will be surrounded by delicious artisan
food, gorgeous gifts, accessories for the
home and garden, jewellery,
demonstrations, workshops, live music,
and the opportunity to explore the
stunning gardens of Arley Hall.
Cheshire Luxury Fair
Arley Hall & Gardens
simplycheshire.co.uk
livingedge.co.uk
11
WHAT’S ON
UP FRONT
Credit: Drew Forsyth
CAN WE BUILD IT?
S
cience and craft collide this
May Bank Holiday with the
Museum of Science and
Industry’s all-ages celebration of
making, MakeFest. Visitors of all
abilities can get involved in DIY tech,
engineering, craft and creativity at
this two-day event taking place on
May 26th and 27th.
Featuring everything from
soldering and stitching to coding
and engineering, the annual
festival has become an exciting
part of the Manchester calendar.
From Bank Holiday Monday
onwards throughout the half term
there will be a host of familyfriendly events, shows and
workshops, including pinhole
camera making, Early Years
engineers and engine
demonstrations.
For adults and older children
Space Descent VR with Tim Peake
allows visitors to fly through space
and pilot a capsule back home
using the latest state-of-the-art
Samsung Gear VR technology.
msimanchester.org.uk
STARS IN YOUR EYES
Matthew Kelly
12
livingedge.co.uk
0DWWKHZ.HOO\LVVHWWREULQJVIDYRXULWH
6WDUVLQWKHLU(\HVEDFNWR0DQFKHVWHUDV
SDUWRIDRQHRIIUHYLYDO
7KHYHWHUDQSUHVHQWHUDQGDFWRUZLOO
KRVWDVSHFLDOYHUVLRQRIWKHPXFKORYHG
VKRZRQ6DWXUGD\-XQHDWWKH5R\DO
1RUWKHUQ&ROOHJHRI0XVLF51&0LQDLG
RI0DQFKHVWHUEDVHG3UHYHQW%UHDVW
&DQFHU
6WDUVLQWKHLU(\HV7KH/LYH5HYLYDO
ZLOOIHDWXUHSHUIRUPDQFHVIURPVRPHRIWKH
VHULHV¶PRVWZHOONQRZQFRQWHVWDQWV
LQFOXGLQJLWVILUVWZLQQHU6KLUOH\%DVVH\
LPSHUVRQDWRU0D[LQH%DUULHDQG*HRUJH
0LFKDHOVRXQGDOLNH5REHUW/DPEHUWL
7KHQH[WJHQHUDWLRQRIWDOHQWZKRZLOOEH
UHYHDOHGRQWKHQLJKWZLOODOVRWDNHWRWKH
VWDJHIROORZLQJDURXQGRIDXGLWLRQVMXGJHG
E\&RURQDWLRQ6WUHHW¶V.\P0DUVKDQG
6KD\QH:DUGODVWPRQWK
0DWWKHZZKRKDVEHHQDVXSSRUWHURI
WKHFKDULW\VLQFHLWVILUVWHYHUIXQGUDLVLQJ
EDOOEDFNLQ1RYHPEHUVDLGµ,¶PD
0DQFKHVWHUER\ZLWKD0DQFKHVWHUVKRZ
DQG,KRSHWKHSHRSOHRI0DQFKHVWHUZLOO
KHOSPHUDLVHPRQH\IRUWKLVIDQWDVWLF
FKDULW\E\FRPLQJDORQJWRKHDUWKRVH
IDPRXVZRUGVµ7RQLJKW0DWWKHZ,¶PJRLQJ
WREH¶IRURQHQLJKWRQO\RQHODVWWLPH¶
%RRN\RXUWLFNHWVDWUQFPDFXN
SHUIRUPDQFHVWDUVLQWKHLUH\HV
holts
ORANGERIES - CONSERVATORIES
Freephone: 0800 085 2338
Telephone: 01565 740579
Email: sales@holts-orangeries.com
Web: www.holts-orangeries.com
DIARY
MY REAL LIFE
Ester knows how to party, but always puts family first.
LOVE MAKES THE WORLD
GO ROUND...
7KLVWLPHRI\HDULVDOZD\VHPRWLRQDODQGDWLPHRIGHHS
UHIOHFWLRQIRUPH
$URXQGWKLVWLPHWKUHH\HDUVDJR,ZDVUHOD[LQJLQ
3UDJXHZLWKP\1DQQD/RRNLQJDWSKRWRVRIXVWRJHWKHU
GXULQJWKDWWLPHPDNHVPHVRJUDWHIXOWKDW,KDGYHU\D
FORVHERQGZLWKVXFKDQDPD]LQJZRPDQ6DGO\,KDYH
QRPRUHFKDQFHVWRVSHQGWLPHZLWKP\1DQQDVR,
HQFRXUDJH\RXWRWHOO\RXUORYHGRQHVMXVWKRZPXFK
WKH\PHDQWR\RX
$V\RXDOONQRZ,¶YHWDSSHGLQWRP\VSLULWXDOVLGH
RYHUWKHSDVWIHZPRQWKVDQG,NHHSILQGLQJZKLWH
IHDWKHUVHYHU\ZKHUH,NQRZLW¶VDPHVVDJHIURPP\
1DQQDUHPLQGLQJPHWRNHHSIDLWKDQGDOZD\VUHPDLQ
WUXHWRP\VHOI
,¶PVWLOOVXSHUEXV\ILOPLQJ5+2&DQGWKLVPRQWKLV
MDPSDFNHGZLWKPRUHODXJKWHUPDJLFDQGRIFRXUVH«
PDGQHVV5HPHPEHUWKDWOLIHLVDIXQQ\EHDXWLIXO
WKLQJ«VROLYHLWDQGORYHLW
Ester xx
AIN’T NO PARTY LIKE
A CHESHIRE PARTY…
As we all know, no one quite throws a
party the way we do in Cheshire!
Nothing is too OTT for us. Who
remembers my bikini launch party
where I arrived in a white carriage
drawn by white horses and sat on a
lavish throne held high in the air by
handsome male models? Yes, nothing
is too extreme for us and the bigger
and the crazier, the better!
I recently attended a flamboyant
Gay Pride party hosted by one of
the girls. We strutted our stuff in
our eccentric outfits and it was a
truly spectacular affair – a colour and
sparkles overload!
Wearing the funkiest silver disco
pants you’ve ever seen, I was
having lots and lots of fun grooving
but at the same time, it meant a lot
that I was also raising awareness of
LGBT issues. I stand for equal rights
for everyone and I send all my
support to the LGBT community.
You are doing us proud!
14
livingedge.co.uk
GIRL POWER AT BEDTIME…
Gay Pride party girl!
Each night, my little girl loves me to
read to her and it’s the highlight of my
entire day.
Sure, we all enjoy reading Cinderella
and Sleeping Beauty from time to
time, but the book that my daughter
loves at the moment is Good Night
Stories for Rebel Girls. Even though
she’s only 3 years old, this book
grasps her attention like no other and
I’m a big fan too!
This book tells the true stories of
the greatest women in history, from
queens to superstars. It makes
perfect bedtime reading and sends
my little princess off to sleep with
positive messages from women all
over the world.
I am giving her
the “girl power”
inspiration each
night and teaching
her from a very
young age that
she can be
whoever she
wants to be!
CAR BODYWORK
DAMAGE?
Mobile Vehicle Bodywork Repairs
On your doorstep
At a time to suit you
With a lifetime guarantee
I’m Simon Homer,
Your Local Revive!
Technician.
BUMPER SCUFFS
Contact me for a free, no obligation quote
ALLOY WHEEL SCRAPES
07967 322 420
MINOR PAINT REPAIRS
PROFILE
BPS FA MILY L AW
BPS Family Law have offices in Manchester city centre
and in the Cheshire villages of Hale and Stockton Heath.
36)DPLO\/DZLVKHDGHGXS
E\&DUROLQH6ZDLQZKRLV
ZLGHO\UHQRZQHGDVRQHRI
WKHPRVWVRXJKWDIWHUGLYRUFH
DQGPDWULPRQLDOILQDQFHODZ\HUVLQWKH8.
&DUROLQHURXWLQHO\UHSUHVHQWVFHOHEULWLHV
KLJKSURILOHFOLHQWVDQGEXVLQHVVSHRSOH
DQGGHDOVZLWKPXOWLPLOOLRQSRXQG
GLVSXWHV6KHLVOLVWHGLQWKHHGLWLRQRI
WKH/HJDODVµ5HFRPPHQGHG/DZ\HU¶
&DUROLQHMRLQHG%36)DPLO\/DZLQ
DQGEHFDPHWKHILUVWIHPDOH3DUWQHUIRUWKH
FRPSDQ\LQ&DUROLQHDWWHQGHG6DOH
*UDPPDU6FKRROVWXGLHGIRUKHUGHJUHHLQ
0DQFKHVWHUDQGQRZOLYHVLQ6WRFNWRQ
+HDWKZLWKKHUIDPLO\
&DUROLQHZRUNVFORVHO\ZLWK+DUU\
/LSVRQZKRKDVUHSUHVHQWHGFOLHQWVERWKLQ
PDWULPRQLDOODZDQGOLWLJDWLRQIRUWKHSDVW
\HDUVZLWK%36+DUU\¶VH[WHQVLYH
NQRZOHGJHDQGH[SHULHQFHLQERWKDUHDVRI
ODZFRPSOHPHQWRQHDQRWKHUSHUIHFWO\
HVSHFLDOO\ZKHQPDWULPRQLDOFDVHVLQYROYH
EXVLQHVVHVDQGHPSOR\PHQWPDWWHUV
&DUROLQHLVDVVLVWHGE\.DUHQ-RQHV
2ULJLQDOO\IURP,UHODQG.DUHQQRZOLYHVLQ
+DOH.DUHQLVDQH[SHUWLQ&KLOG/DZDQG
UHSUHVHQWVIDPLOLHVZKRILQGWKHPVHOYHVLQ
GLVSXWHRYHUDZLGHUDQJHRISDUHQWDO
LVVXHV.DUHQ¶VVNLOOVDUHVRXJKWE\PRWKHUV
IDWKHUVDQGJUDQGSDUHQWV6KH
XQGHUVWDQGVKRZGLIILFXOWGLVSXWHVLQ
UHODWLRQWRFKLOGUHQDUHDQGZRUNVLQDQ
%
Harry Lipson
Karen Jones
What Legal 500 has
to say about us:
“BPS Family Law LLP has its clients’
interests at heart, but also remains
very professional and level-headed. It
covers the pros and cons of each
situation in detail and the client
always has a clear understanding of
each issue and the next course of
action.” “The ‘very dedicated and
hardworking’ Caroline Swain is
praised for her ‘professionalism,
compassion, common sense and
calming influence.’ The team advises
on the full spectrum of family law
issues.”
Caroline Swain at BPS Law
HPSDWKHWLFDQGHIILFLHQWPDQQHUWRDFKLHYH
WKHEHVWRXWFRPHIRUFOLHQWVDQGWKHLU
FKLOGUHQ
%36)DPLO\/DZRIIHUVDIUHHLQLWLDO
FRQVXOWDWLRQDYDLODEOHDWDOOWKUHHRIILFHV
7KH\RIIHUIL[HGIHHVDQGSD\PHQWSODQVVR
\RXFDQFRPIRUWDEO\PDQDJH\RXUOHJDO
IHHV7KH\ZLOOVFKHGXOHPHHWLQJVWRVXLW
\RXUZRUNDQGFKLOGFDUHFRPPLWPHQWV
7KHLU+DOHDQG6WRFNWRQ+HDWKRIILFHV
KDYHEHHQGHVLJQHGE\LQWHULRUGHVLJQ
H[SHUWVWRSURYLGHDZDUPDQGIULHQGO\
HQYLURQPHQW<RXFDQH[SHFWDFRPIRUWDEOH
VHWWLQJZKLOVW\RXGLVFXVVKRZWKHILUPFDQ
KHOS\RX
&DUROLQH6ZDLQVD\Vµ2XUH[SHULHQFH
KDVWDXJKWXVWKDWRXULQYROYHPHQWLQ\RXU
OLIHFRPHVDWDQHPRWLRQDOO\SUHVVXUHG
WLPH)DPLO\UHODWHGLVVXHVRIWHQDULVH
RXWVLGHRIXVXDORIILFHKRXUVZHDUH
DYDLODEOHWRRXUFOLHQWVDURXQGWKHFORFNIRU
PHHWLQJVDQGWHOHSKRQHFDOOVWRHQVXUHWKDW
WKHUHLVDOZD\VVRPHRQHWRVSHDNWRGXULQJ
\RXUPRVWGLIILFXOWGD\V¶
What our clients have
to say about us:
“I have a critical eye with an attention
to detail. I have been very impressed
by BPS Family Law across the board.
“This is a particularly difficult time for
me. The availability even out of the
already long hours, reassurance,
understanding, explanations,
guidance and billing flexibility have
been outstanding; whilst still not
departing from reality. I cannot
imagine a better service. Caroline is
an exceptional individual with an
excellent grasp of her subject but not
afraid to ask for technical help from
other professionals if something is
outside of her field. That said, it
would need to be non-legal!
‘She is an assiduous player and
clearly experienced and confident in
the advice she gives and the
explanations she provides. Her
technical knowledge and execution
are inspiring, reassuring and
exemplary. Her commercial
awareness reflects her years of
experience.’
ESVIDPLO\ODZFRXN
This promotional feature was brought to you by the editorial team at Living Edge. If you would like your business to feature in our pages
contact our commercial manager Claire Cooper at claire.cooper@archant.co.uk or 07918 696074.
16
livingedge.co.uk
“BPS helped me through the worst
period of my life. Their approach
was not only personable but also
professional. We won my case even
when all the odds were against us.
I fully endorse BPS and would
recommend them to anyone who
needs more than a solicitor”
Specialising in:
Divorce & Separation
Financial Settlements
Child Related Matters
Offering to clients:
Meetings outside
business hours
Free initial consultation
Fixed Fees
Flexible payment plans
CAROLINE SWAIN
Partner Solicitor
Specialising in Divorce Law
Manchester 0161 834 2623 | Hale 0161 926 1430 | Stockton Heath 01925 91 22 77
caroline.swain@bpsfamilylaw.co.uk
www.bpsFamilyLaw.co.uk
Cayenne preview evening
Porsche Centre Chester was delighted to welcome over 300 guests
to their Centre for the official preview of the new Porsche Cayenne
I
n December of last year, Porsche
Centre Chester offered a sneak
preview of the new Cayenne
to visitors in the showroom for
one week only. The car received such
phenomenal feedback that the team at
the Centre were delighted to welcome
not one but three Cayennes back to
the showroom for the official launch.
This included a standard Cayenne,
a Cayenne S and a Cayenne Turbo.
The new Cayenne has been a highly
anticipated vehicle in the Porsche
range and one that many have been
eagerly awaiting.
A car launch at Porsche Centre
Chester is always a very popular
occasion, and this one was no
exception. Talented singer Sumudu
entertained the guests with jazz,
pop and soul music whilst a variety
of beautiful canapes were served,
including shallot and honey marinated
lamb fillet, peri peri chicken, mini black
forest cherries and white chocolate
praline lollipops.
After an introduction from Centre
Principal Carl Hazelton and David
Metcalf of Porsche Cars Great Britain,
the new Cayennes were unveiled to
guests and for many, this was the first
glimpse of the new model. As well as
drinks and canapés served throughout
the evening, guests enjoyed being able
to explore the Porsche model range
and discuss all things Porsche with
like-minded individuals.
The completely redeveloped
Cayenne is even closer to its roots
as a Porsche sports car than its
predecessor, boasting lightweight
construction, powerful drives,
exceptional driving dynamics and
smart driver assistance systems. All
of this is combined with outstanding
handling on any terrain, improved
comfort and greater suitability for
everyday use.
The Cayenne has always been
comfortable off road and now, with this
enhanced new model, the Cayenne
is more capable than ever, with the
driver able to choose between five
pre-programmed drive and chassis
modes, depending on the terrain.
It has always been the perfect car
for taking on an adventure and
items from the Porsche equipment
range, such as the Porsche roof
box and bicycle rack, are there to
enhance this experience further.
With the new generation
Cayenne, the car is writing a
new chapter in the relationship
between driver and vehicle. The
centre console comes with Direct
Touch Control and the new 12.3inch touch display system.
The new Cayenne comes
fully networked and connected
as standard. It comes with an
extensive range of new features
and services including Apple Car
Play, which allows you to connect
your iPhone to make calls, listen
to news, or stream your favourite
music. Porsche Connect also
offers online navigation, including
real-time traffic information,
risk radar, voice pilot and an offroad precision app, exclusively
for the Cayenne. It also comes
with an LTE telephone module
with integrated SIM card,
mobile phone preparation with
Bluetooth® interface, a Wi-Fi
hotspot and four USB ports.
Sumudu
Chris Nickson and Amy Hughes
Olivia Rylance and Matt Vheue
Tony and Sue Hunt
The new Cayenne is now available to order at Porsche Centre Chester. For further
information on this model, or to arrange a demonstration drive*, please call the team on
0151 373 4899 • info@porschechester.co.uk
*Age and licence restrictions apply
Party into the night
Credit: Gobinder Jhitta
COMPETITION
WIN!
We have two pairs of Adult Weekend Camping tickets to Rewind North, taking place
at Capesthorne Hall from 3 to 5 August 2018, to give away, worth £280 each!
5
7+(-$&.6216‡20'‡%,//<2&($1‡
7+(%22072:15$76‡0$5&
$/021'‡+2:$5'-21(6‡628/,,
628/‡+($9(1‡%211,(7</(5‡
0,'*(85(‡67(9(+$5/(<
&2&.1(<5(%(/‡7+(81'(5721(6‡
/(26$<(5‡7,))$1<‡%,*&28175<‡
+8(&5<‡7+(),==‡:(1'<-$0(6
2)75$169,6,219$03‡.,0$33/(%<‡
,0$*,1$7,21‡52$&+)25'‡&$37$,1
6(16,%/(‡086,&$/<287+‡'2&725
7+(0(',&6‡6SHFLDOV'-VHWE\
0$57,1.(03‡&RPHG\E\0,/721
-21(60,&.)(55<056%$5%$5$
1,&(
Credit: Jerry Tremaine
HZLQGLVWKHJUHDWHVWIHVWLYDO
FHOHEUDWLRQRIVRPHRIWKHPRVW
XQIRUJHWWDEOHPXVLFHYHU
EULQJLQJ\RXOLYHRQVWDJHLQ
&KHVKLUHVRPHRIWKHELJJHVWEDQGVDQG
JUHDWHVWKLWVRIDOOWLPH
(QWHUQRZWRZLQDZHHNHQGRIPXVLF
DQGIXQ\RXZRQ¶WHYHUIRUJHW%ULQJDWHQWRU
ERRNDJODPSLQJRSWLRQYLVLWQRUWK
UHZLQGIHVWLYDOFRPERXWLTXH
DFFRPPRGDWLRQDQGSUHSDUHWRERRJLHWKH
ZHHNHQGDZD\WRWKHVRXQGVRIWKH¶VIURP
7RSRIWKH3RSVVWDUVLQFOXGLQJ
To enter, simply answer the
following question: What was
Heaven 17’s best known hit?
$7ULEXODWLRQ
%7HPSWDWLRQ
&([SHFWDWLRQ
6XEPLW\RXUDQVZHURQOLQHDW
ZZZOLYLQJHGJHFRXNRUVHQG\RXUDQVZHU
RQDSRVWFDUGZLWKIXOOFRQWDFWGHWDLOV
LQFOXGLQJ\RXUHPDLODGGUHVVDQGWHOHSKRQH
QXPEHUE\-XQHWR
/LYLQJ(GJH5HZLQG&RPSHWLWLRQ$UFKDQW
7KH%DUQ(OPV)DUP+REE/DQH
'DUHVEXU\:DUULQJWRQ:$/6
Bob Geldof, The Boomtown Rats
Terms & Conditions: Competition entrants must be aged 18 years or over and be UK residents. The winners will be the first correct entry drawn after the closing date of 4 June 2018. The
editor’s decision is final. There are two prizes of one pair of Adult Weekend Camping Tickets to Rewind North. Weekend Camping Tickets allow access to the Festival Campsite for three nights
(Friday-Sunday inclusive) and the Festival Arena for three days (Friday-Sunday inclusive) Please note that this is the ticket type required for access to the Campervan and Boutique Camping areas.
Campervan not included. Adult Tickets are for customers aged 18 years and over. For more information about campervans and passes for campervans, please visit: north.rewindfestival.com/
tickets/ The prize is non-transferable and there is no cash alternative. Promotor: Rewind Festival | rewindfestival.com. For Full T’s&C’s including details of opt out please visit www.archant.co.uk.
20
livingedge.co.uk
ATICUS FAMILY & DIVORCE LAW
Let’s focus on
your family law
issue together
We can help you to deal with whatever issues
arise constructively and with sympathy.
• Divorce
• Financial Matters
• Children Disputes
• Cohabitation Disputes
• Civil Partnership Dissolution
• Domestic Violence
• Change of Name Deeds
As Head of the
Family Department
here at Aticus Law
I can ensure that
you receive the
personal touch and
the discretion that
you require so you
can be assured of the right outcome
in your case. Call or email me today
for a free no obligation chat about
your future.
Rachel Ward | Head of Family
Sophisticated, effective and clear advice
Unrivalled experience | Safeguarding your rights
www.aticuslaw.co.uk
Manchester Queens Chambers, 5 John Dalton St, Manchester M2 6ET
Wilmslow Camellia House, Water Lane, Wilmslow SK9 5BB
London The Shard, 32 London St, London SE1 9SG
T. 08700 245 007 F. 0161 819 5599 E. rachel.ward@aticuslaw.co.uk
BUSINESS AWARDS 2017
Winner of the Boutique Law
Firm of the Year in the Talk of
Manchester Business Awards
Aticus Law Ltd is authorised
and regulated by the Solicitors
Regulation Authority
A years worth of research brought a couple from Whiteield
back to local company Diane Berry Kitchens.
Whilst they were keen to embrace modern, open-plan living
they wanted to retain a traditional, elegant dining space away
from a busy kitchen.
Diane and her team of innovative designers created something
for the couple which others hadn’t. Their plan was far removed
from the mediocre designs produced by others; it met this
customer’s brief for something unusual and eye-catching. Whilst
undoubtedly contemporary in the look and flow, the space is
neatly divided by a partition wall providing the coveted separate
dining space, perfect for visiting family.
Crucially the client wanted to introduce curves into the
design; Diane delivered this with a striking curved kitchen
peninsula. A quartz worktop and shell mother of pearl back
panel adds opulence and light and faces the garden view.
Despite its delicate, soft appearance the kitchen provides
a robust and practical working space which as keen cooks,
the couple need. The family agrees that the inished space
is beautiful, they love the warming cashmere colours which
complement the surrounding neutral tones.
They found Diane’s company to be reliable and professional
and willing to go further to deliver their design, however out
of the ordinary it may have been.
Diane Berry Kitchens Ltd,
132 Bury New Road,
Prestwich, Manchester, M25 0AA
www.dianeberrykitchens.co.uk
diane@dianeberrykitchens.co.uk
Tel: 0161 798 5335
FAMILY LAW
Local solutions to complex problems
With over 20 years of experience in divorce and financial
settlements, our Head of Family Law, Gail Cartwright,
can provide you with expert legal advice and assistance
throughout your divorce or separation.
We specialise in all financial aspects of divorce and
separation, including cases with significant financial assets
and complex circumstances - this being said, we can deal
with any family law matter, no matter how big or small. In
addition to this, our Conveyancing department can deal
with any property issues you may have.
Based in the Old Town Hall in West Didsbury, we provide
local, face-to-face consultation and tailor our efforts
towards your needs. To arrange a free consultation, please
call 0161 446 1122 or email enquiries@pablasolicitors.co.uk
Because family matters
■ Divorce ■ Financial Settlements ■ Dissolution of Civil Partnerships ■ Nuptial and Separation Agreements
■ Issues Concerning Children ■ Protection from Domestic Violence ■ Cohabitation Contracts
0161 446 1122 enquiries@pablasolicitors.co.uk www.pablasolicitors.co.uk
The Old Town Hall, Lapwing Lane, West Didsbury M20 2NR
We offer a free consultation and a range of funding options to suit your individual needs
We are a Cosmetic Dental Clinic with a
wealth of experience in full mouth
rehabilitation, dental implants, teeth
straightening and cosmetic dentistry.
— Your smile is our reputation —
Smile transformation of the month
Before
After
Before
After
T
his patient came into the practice recently for a free consultation
with our smile advisor Jane. Her main concerns were the height of
her old crowns and the appearance of her upper gums. She also
didn’t like her lower teeth and how crossed over they were. The
previous crowns were very old and didn’t fit in with the patient’s youthful
style and appearance. As time went on she was getting increasingly more
self-conscious about her smile and this was affecting her confidence.
Before committing to a paid assessment she wanted to understand which
treatments options were available to her and the costs involved.
In the consultation, the option of replacing the old crowns and doing
some teeth whitening were discussed. This would give the patient a
refreshed, brighter and wider smile. Our smile advisor Jane discussed
the patient’s main concerns and took images. An appointment was then
arranged for a cosmetic consultation with Dr Karim.
In a full comprehensive assessment with Dr Karim, a series of photographs
were taken in conjunction with a 3 dimensional scan using our cutting
edge digital scanner. This helped to explain to the patient the different
treatment options that were available. We later used this digital scan to
produce a mock up of the patient’s new crowns and veneers, therefore
involving the patient in the design process.
A lower fixed brace was initially used to straighten her lower teeth.The
gum growth was removed and crown lengthening was performed in order
to reposition the gum line giving the crowns and the smile more symmetry.
The lower teeth were treated with enilghten teeth whitening to achieve a
much lighter colour. The upper crowns and veneers were ultimately
changed for new, all ceramic emax crowns and veneers which completely
transformed the smile from an aged smile to a very youthful one.
If you would like to know about which options may be available to you
please give us a call or If you would like to explore more treatments similar
to this, please call Jane on 0161-486-0743 to book in for a free non-obligation
consultation quoting LIVINGEDGE.
Before
After
Start your smile journey and book your FREE CONSULTATION
by quoting LIVINGEDGE.
Church Road Dental and Cosmetics,
32 Church Road, Cheadle Hulme, SK8 7JB
E: reception@cheadlehulmedental.com
www.cheadlehulmdedental.com
Check our
website for
more smile
transformations
After
PROFILE
CHURCH ROA D DEN TA L
AND COSMETIC
Dr. Shi Karim tells us how he has created the perfect balance of
preventative care and cosmetic dentistry at his Cheadle Hulme practice.
KXUFK5RDG'HQWDODQG
&RVPHWLFKDVEHHQDVWDOZDUW
RI&KHDGOH+XOPHVLQFH
ZKHQLWZDVIRXQGHGE\'U
%HGGDUG,Q'U6KL.DULPWRRNRYHU
WKHSUDFWLFHDQGKDVVLQFHEXLOWVWURQJO\RQ
WKHIRXQGDWLRQVILUVWODLGE\'U%HGGDUG
6KLVD\Vµ7KHJRDOZDVWRKDYHDSUDFWLFH
WKDWSXVKHGWKHERXQGDULHVLQQHZ
WUHDWPHQWVEXWDOVRRIIHUHGFRPIRUWDQGVW\OH
7KHDLPZDVWRPDNHSDWLHQWVIHHODVUHOD[HG
DVSRVVLEOHPRUHRIDVSDOLNHIHHODQGOHVV
OLNHWKH\ZHUHFRPLQJWRWKHGHQWLVW&XWWLQJ
HGJHWHFKQRORJ\KDVDOZD\VEHHQDWWKH
IRUHIURQWRIGHYHORSLQJWKHSUDFWLFHWKLVKDV
UHDOO\KHOSHGSDWLHQWVDSSUHFLDWHKRZIDU
GHQWLVWU\KDVFRPHLQUHFHQW\HDUV:H
FXUUHQWO\ERDVWDQLQKRXVH&76FDQQHUDQ
,QWUD2UDO'LJLWDO6FDQQHUZKLFKPHDQVQR
PRUHJRRH\LPSUHVVLRQVDQGDOOURRPVKDYH
LQWUDRUDOVFDQQHUVDQGGLJLWDO6/5FDPHUDV
2XUGHQWLVWVDUHDOOYHU\KLJKO\TXDOLILHGDQG
FRQWLQXHWRFRQVWDQWO\SURJUHVVWKHPVHOYHV
E\DWWHQGLQJQXPHURXVFRXUVHV¶
,W¶VUDUHWRPHHWSHRSOHZKRHQMR\DYLVLW
WRWKHGHQWLVWUHJDUGOHVVRIWKHVWDWHRIWKHLU
VPLOHDIDFW'U.DULPLVZHOODZDUHRIDQG
SD\VFORVHDWWHQWLRQWR
&
Dr Shi Karim
µ:HWDNHWLPHZLWKRXUSDWLHQWVJRLQJ
WKURXJKWUHDWPHQWVDQGH[SODLQLQJLQGHWDLO
WKHGLIIHUHQWRSWLRQV¶KHVD\Vµ:HRIIHUD
SULYDWHFRQVXOWDWLRQURRPDZD\IURPWKH
GHQWDOVXUJHU\HQYLURQPHQWWRKHOSSDWLHQWV
IHHOPRUHUHOD[HGDQGDWHDVH:HDGDSWHGWR
WUHDWHDFKSDWLHQWDVDQLQGLYLGXDO7KH
SUDFWLFHLV'HQWDO3KRELD&HUWLILHGZKLFK
PHDQVWKDWZHKDYHUHFHLYHGDQDFFUHGLWDWLRQ
LQUHFRJQLWLRQRIRXUDSSURDFKWRWUHDWLQJ
QHUYRXVSDWLHQWV2QHLQQRYDWLRQWKDWPDNHV
DELJGLIIHUHQFHLVWKHXVHRIWKHDQDHVWKHWLF
ZDQG$OLWWOHOLNHDSHQWKLVLVDZD\RI
GHOLYHULQJDSDLQOHVVLQMHFWLRQ:HDOVRXVH,9
VHGDWLRQIRUYHU\QHUYRXVSDWLHQWV¶
6LQFHWDNLQJRYHUWKHSUDFWLFH'U.DULP
KDVZRUNHGVWHDGLO\WRGHYHORSWKHFRVPHWLF
GHQWLVWU\DQGRIIHUWKHODWHVWLQQHZGHQWDO
WUHDWPHQWVDQGWHFKQRORJ\+RZHYHUKLV
PDLQIRFXVIRUSDWLHQWVZLOODOZD\VEH
SUHYHQWDWLYHFDUHWKHUHDVRQZHDOOYLVLWRXU
GHQWLVWVHYHU\VL[PRQWKV
µ:HZRXOGRQO\DOORZSDWLHQWVWRKDYH
HOHFWLYHFRVPHWLFWUHDWPHQWVRQFHWKH\KDYH
VKRZQDKLJKOHYHORIFOHDQLQJDQGRUDOKHDOWK
FDUHDQGRQFHWKHPRXWKLVGLVHDVHIUHH$V
ZHOODVWDNLQJUHIHUUDOVIURPRWKHUGHQWLVWV
ZHDUHVWLOOXOWLPDWHO\DIDPLO\IULHQGO\GHQWDO
SUDFWLFH:HRIIHUGHQWDOSODQVZKLFKVWDUW
IURPDVOLWWOHDV…SHUPRQWK7KLVPDNHV
URXWLQHGHQWDOWUHDWPHQWPRUHDIIRUGDEOH
DQGKHOSVSDWLHQWVPDLQWDLQJRRGRUDOKHDOWK
DQGSUHYHQWIXWXUHSUREOHPV
µ:HRIIHUDFRPSOHWHUDQJHRIFRVPHWLF
RSWLRQVIURPRUWKRGRQWLFVWHHWK
VWUDLJKWHQLQJWRGHQWDOLPSODQWVIXOOPRXWK
UHFRQVWUXFWLRQVFURZQVEULGJHDQGYHQHHUV
WHHWKZKLWHQLQJDQGZULQNOHVRIWHQLQJDQG
IDFLDODHVWKHWLFV
µ,¶PYHU\SURXGRIZKDWZHKDYHEXLOW
KHUH2XUSUDFWLFHDQGGHQWLVWVKDYHZRQ
VHYHUDODZDUGVRYHUWKHODVWIHZ\HDUV
LQFOXGLQJ<RXQJ'HQWLVWRIWKH<HDUIRU'U
6WHSKHQ'RGGDQGEHLQJVKRUWOLVWHGIRU%HVW
3UDFWLFHLQWKH1RUWK:HVW7KLVRQO\FRPHV
ZKHQ\RXSXWWKHSDWLHQWILUVW7KLVLVWKH
FRUHRIRXUHQWLUHHWKRVKRQHVW\LQWHJULW\
DQGJRRGFRPPXQLFDWLRQZLWKWKHSDWLHQWDW
WKHFHQWUHRIHYHU\WKLQJZHGR¶
&KHDGOH+XOPH_
FKHDGOHKXOPHGHQWDOFRP
livingedge.co.uk
27
Imagination • Design • Quality
Cheshire Tile & Bathroom Studio
is illed with the latest designs
and inspiring ideas from leading
bathroom brands such as
Catalano, Laufen, & Cerasa.
We offer a full bathroom design service where an
appointment can be made with one of our designers
to sit down and discuss your requirements and best
use of space over a coffee, we can then produce
drawings and photo-realistic imagery, should they be
required, which can be viewed at your next visit.
CHESHIRE TILE
& BATHROOM STUDIO
Our extensive showroom offers a wide ranging
collection of ceramics from elite European tile manufacturers,
ensuring that our customers have a vast array of products to
choose from whatever their project entails.
As one of the country’s leading floor and wall tile specialists
our range is extensive, from mosaics to wood and stone effect,
from classical to contemporary.
Many tiles are created using the very latest digital printing
technology allowing a myriad of inishes, colours and designs.
It makes it possible to decorate the whole tile, from edge to
edge, guaranteeing perfect deinition, Floor and wall tiles which
are surprisingly realistic. From natural stone to wood, to fabric
effects to patterns, the options are endless.
Unit 1C, Duke Avenue, Stanley Green Retail Park
Cheadle, Cheshire SK8 6PT
0161 485 7073
www.cheshiretileandbathroom.co.uk
INTERVIEW
FOREVER
HERSELF
Seema Malhotra, of Real Housewives of Cheshire fame,
talks fashion, the future and feisty women
HHPD0DOKRWUDZDVDVXFFHVVIXO
EXVLQHVVZRPDQEHIRUHKHUILUVW
DSSHDUDQFHRQ,79%H¶V5HDO+RXVHZLYHV
RI&KHVKLUHWKHUHDOLW\VKRZWKDWGUDZV
RYHUYLHZHUVHYHU\ZHHNDQG,ZRQGHUKRZ
RQHDUWKDQGZK\6HHPDZRXOGJHWLQYROYHGZKHQ
VKHKDVDIXOOWLPHMREUXQQLQJKHUVXFFHVVIXOIDVKLRQ
EUDQG
µ0RUHWKDQDQ\WKLQJIRUPH¶VKHVD\VµLWZDVD
JUHDWSODWIRUPWRJRRQDQGKRSHIXOO\EHLQVSLUDWLRQDO
IRU\RXQJHUJLUOVVD\LQJWKDWLI\RXGRZRUNKDUG\RX
FDQDFWXDOO\EHVRPHWKLQJDQGDFKLHYH
µ7KHZD\,ZDVEURXJKWXSLWZDVDOZD\V³ZRUN
KDUGGUHDPELJEHSRZHUIXODQGDFKLHYH´0RQH\¶V
QRWHYHU\WKLQJWRPHLW¶VWKDWDFKLHYHPHQWWKDWVHQVH
RIDFWXDOO\JHWWLQJVRPHZKHUHDQGORRNLQJEDFNDQG
VD\LQJ³,GLGWKDW´WKDW¶VZKDW\RXJHWWKHPRVW
KDSSLQHVVIURP
µ,VWXGLHGIDVKLRQDQGKDGDQRIIHUWRJRWR6W
0DUWLQVLQ/RQGRQWRFRQWLQXHP\VWXGLHV¶VKHVD\V
µEXW,FRPHIURPDQ,QGLDQIDPLO\DQGP\SDUHQWVZHUH
UHDOO\VWULFWDQGP\IDWKHUZRXOGQ¶WDOORZLW,KDGDQ
DUUDQJHGPDUULDJHEXWZKDW,ZDVUHDOO\OXFN\LQLVLQ
KDYLQJDKXVEDQGWKDWUHDOO\HQFRXUDJHGPHDVGLGP\
PXPVKHDOZD\VVDLGLI\RXUHDOO\ZDQWWRGR
VRPHWKLQJDQGEHVRPHRQHGRQ¶WEHVFDUHGMXVWGRLW
+DYLQJWKHEDFNLQJRI6DQGHHSP\KXVEDQG«ZHOOKH¶V
EHHQP\URFN¶
6HHPDDQG6DQGHHSVWDUWHGVPDOOEX\LQJ
(XURSHDQIDVKLRQVDQGVHOOLQJRQWRPDUNHWWUDGHUVLQ
WKH1RUWK:HVW
µ:KDWVWDUWHGDVJRLQJWR/RQGRQLQDEDWWHUHGROG
ZKLWHYDQOHGWRJRLQJWR3DULVDVIDVKLRQDJHQWVDQG
ZRUNLQJZLWKYHU\KLJKHQGEUDQGVVXFKDV0DMHDQG
6DQGUR2QFHZHJRWLQWRVRPHQLFKHERXWLTXHVP\
KXVEDQGVDLG³<RX¶YHDOZD\VZDQWHGWRGR\RXURZQ
FROOHFWLRQVRMXVWGRLWKDYHDJR´:HGHFLGHGZH¶G
MXVWPDNHDVPDOOWHQSLHFHFDSVXOHFROOHFWLRQZKLFK,
ZHQWWRWKH)DU(DVWDQGSURGXFHGLWVROGRXWZLWKLQD
6
30
livingedge.co.uk
IHZZHHNVDQGWKDW¶VZKHQ)RUHYHU8QLTXHZDVERUQ¶
7KHILOPLQJFRPPLWPHQWIRU5HDO+RXVHZLYHVLV
FRQVLGHUDEOHVRKRZGRHV6HHPDPDNHLWDOOZRUN"
µ,¶PEOHVVHG,¶YHJRWDQDPD]LQJIDPLO\DQGWKH
WHDPDW)RUHYHU8QLTXHDOOVXSSRUWPHDQG,¶PGRLQJ
LWIRUWKHEUDQG$QG,KDYHWRVD\0RQNH\.LQJGRP
>WKHSURGXFWLRQFRPSDQ\@KDYHEHHQDPD]LQJZLWKPH
WKH\XQGHUVWDQGP\ZRUNVFKHGXOHDQGDUHUHDOO\
WKRXJKWIXOWKDW,KDYHP\EXVLQHVV
µ,W¶VEHHQDQDPD]LQJH[SHULHQFHDQG,¶YHORYHG
HYHU\PRPHQWRILWKDYLQJWKDWWLPHZLWKWKHJLUOV
JHWWLQJDZD\DQGKDYLQJVRPHJLUO\WLPHLW¶VIXQ,¶YH
QHYHUKXQJRXWZLWKDEXQFKRIJLUOVDQG\HVWKHUH¶V
GUDPDDQGWKHVHZRPHQDUHVREROGVRVWURQJDQGVR
YRFDO±EXWWKDW¶VZKDWP\EUDQGLV(VWHUDQG,DUH
ZRUOGVDSDUWEXWVKHVDLG³6HHPD\RXQHHGWRGUHVV
PH´DQG,ORYHWKDW,ORYHVW\OLQJWKHPDQG,ORYH
VKRZLQJWKDW\RXFDQVWLOOEHEROGDQGVWURQJEXW\RX
FDQGRLWLQDFODVV\ZD\¶
:KHQ6HHPDILUVWODXQFKHG)RUHYHU8QLTXHLWZDV
YHU\PXFKUHGFDUSHWVW\OHEXWRYHUWKHVHDVRQVWKH
EUDQGKDVHYROYHGLQWRDEURDGHURIIHULQJ
µ:HKDYHWKHFRXWXUHGUHVVHVWKHQZHKDYHRXU
PDLQOLQH¶VKHVD\VµEXWZH¶YHDOVRODXQFKHGWKH<RX
FROOHFWLRQZKLFKLVGD\WRQLJKW±,ZDQWHGLWWREH
DIIRUGDEOH,ZDQWHGLWWREHWKDW\RXFDQYLVLWWKH
ZHEVLWHRUJRLQVWRUHHYHU\ZHHNDQGEX\WKHEUDQG
LW¶VWKHHDV\SLHFHVWKDW\RXFDQSLFNXSEXWWKH\VWLOO
KDYHWKHKDQGZULWLQJRI)RUHYHU8QLTXH,W¶VPDNLQJLW
DOLIHVW\OHDRQHVWRSVKRSIRUDOORFFDVLRQV¶
6RZKDWGRHVWKHIXWXUHKROGIRUWKLVYHU\EXV\
ODG\"
µ,GRQ¶WUHDOO\SODQWKDWIDUDKHDGVRIDU,¶YHUHDOO\
HQMR\HGP\H[SHULHQFH>RQ5+2&@DQG,UHDOO\ZDQWWR
UHPDLQRSHQPLQGHGZLWKLW,W¶VEHHQJUHDWIRUPHDQG
WKLVVHULHV\RXJHWWRVHHPRUHRIP\FKDUDFWHUDQG
UHDOO\JHWWRNQRZPH¶
IRUHYHUXQLTXHFRXN
livingedge.co.uk
31
The Gardens and Grounds Experts
Mon-Sat: 08:00 - 18:00
All types of Commercial and domestic
Grounds maintenance undertaken
Lawn mowing
Weeding
Spraying
Hedge trimming
Shrub pruning
Tree & hedge planting
Garden clearance
Litter picking
Fencing
Shrub clearance
Cheshire Grounds Maintenance
37 Melrose Avenue, Burtonwood,
Warrington, Cheshire, WA5 4NW
Telephone: +(44) 07803 741261
01565 889900
info@cheshiregroundsmaintenance.co.uk
www.cheshiregroundsmaintenance.co.uk
T H E LY M M H OT EL
FATHER’S DAY
WEDDINGS
FATHER’S DAY LUNCH
WHIRLWIND WEDDING PACKAGE
Enjoy a delightful three course meal including
a drink for Dad!
Our elegant and friendly hotel is a perfect
choice for weddings.
£19.95 adult, £12.95 children under 12 years,
under 2s eat free!
Whirlwind Wedding Package at £1,900. Book your wedding
before August 2018.
To book, or for more information, please call 0344 879 9047 or email general.lymm@macdonald-hotels.co.uk
Whitbarrow Road, Lymm, Warrington, Cheshire WA13 9AQ
W W W. M AC D O N A L D H O T E L S . C O . U K / LY M M
Weding
Open Day
SUNDAY 13th MAY
11am until 3pm
Be the first to see our new outdoor
ceremony space dressed to impress!!
Come along and meet the dedicated
wedding co-ordinators, suppliers and
other happy couples.
No appointments are necessary, feel
free to pop along and picture your
dream day at your dream venue.
FOR MORE INFORMATION
PLEASE CALL 01625 529211
OR VISIT
www.pinewood-hotel.co.uk
Best Western PLUS
Pinewood on Wilmslow
Fine antique furniture,
French antiques,
objets de vertu, paintings,
prints & books, china,
jewellery, decorative arts,
hallmark British silver
& painted furniture.
STOCKISTS OF ANNIE SLOAN
CHALK PAINT
Three loors of fine quality antiques and collectables - Open every day except Monday
113 King Street, Knutsford, Cheshire, WA16 6EH (Jnc 19, M6)
Telephone: 01565 654092 | www.knutsfordantiques.co.uk
On trend
ART
Tracy Hill on residency at Warrington Museum
& Art Gallery
DYNAMIC ART
WELSH INSPIRATION
A
Welsh Connection, a new
exhibition launching at
Contemporary Six on May 12,
celebrates the strong affinity that people
from the North West have with North
Wales. The exhibition of 35 paintings,
capturing coastlines and harbours,
illustrates Anne’s skill in depicting
An artful gift
/RFDODUWLVWDQGVFXOSWRU-DQH5REELQVKDV
JLIWHGDXQLTXHZRUNDEXVWRIWKH
VXIIUDJHWWH(PPHOLQH3DQNKXUVWWR7KH
3DQNKXUVW&HQWUHLQ0DQFKHVWHUWR
FRPPHPRUDWHWKHFHQWHQDU\RIZRPHQ
JHWWLQJWKHYRWH
-DQHVDLGµ,JLIWHGWKHSLHFHWRWKHFHQWUH
EHFDXVH,IHOWWKHSODFHQHHGHGD'IRFDO
SRLQWRIDQLPDJHRIWKHZRPDQLW¶VQDPHG
DIWHU7KH\¶UHQRZFXUUHQWO\UDLVLQJIXQGV
WRJHWLWFDVWLQWRUHDOEURQ]HVRLWFDQJR
RXWGRRUVLQWRWKHLUQHZO\ODQGVFDSHV
JDUGHQVGXHWREHXQYHLOHGWKLVVXPPHU¶
-DQHZRUNVIURPKHUKRPHEDVHGVWXGLRLQ
0REEHUOH\DQGKDVEHHQDSRUWUDLWDQG
ILJXUDWLYHVFXOSWRUVLQFHDQGD
WKHDWULFDOSURSPDNHUEHIRUHWKDW
Porthdinllaen, High Tide, by Anne Aspinall
reflections, light, and movement.
Artist Anne Aspinall, 68, who lives in
Macclesfield, said: ‘I have always
loved that North Wales hides its best
places and keeps them a secret. If you
are open to its charms, it’s a place that
gradually seeps into your being.’
12 - 31 May | contemporarysix.co.uk
Now on display at Warrington
Museum & Art Gallery are the new
capacitive ink screenprints and gallery
wall drawings from Warrington
Contemporary Arts Festival 2017
prizewinner, Tracy Hill.
Inspired by the remnant
mosslands around Warrington, Hill
uses commercial mapping
equipment to capture the essence
of these unique places. Recorded
via a portable 3D laser scanner she
applies the data from 360 degree
scans to create multi-layered
images. For the first time four of
her ground-breaking conductive ink
screenprints are being exhibited in
the gallery. These works offer
visitors the opportunity to lightly
touch the prints to hear recorded
sounds from local nature reserve
Risley Moss. Offering a multisensory experience is important to
the artist as it allows visitors to
re-imagine a new future for these
vital wetland spaces.
Haecceity: Tracy Hill
Until 16 June
Julie Hesmondhalgh and
Jane Robbins, at the
Pankhurst Centre.
livingedge.co.uk
35
German engineering
for your home...
www.weru.co.uk
Why settle for less when you can have
Europe’s finest windows, entrance doors
and patios from your local experts. We have
installed our products in excess of 15,000
local North West homes over the last 30 years.
ALWAYS at the fore front of technology
WERU specialise in energy efficient
products. Their Afino range of windows
is their most popular with Uw values as
low as 0.68WmK² using state of-the-art
fipro-rau technology.
The range is complimented by WERUs
Atris Door collection (Ud values as low
as 0.47WmK²) with an unparalleled selection
of styles and options.
Another speciality is their HS220mm
panoramic sliding patio door system,
catering for very large apertures, for
example, 6 metres as two panel with almost
frictionless sliding motion.
Aluminium bi-folding doors are as equally
well engineered and available in all formats.
WERU offer the challenge to find any other
system or manufacturer that can even come
close to their vast product choice and most
importantly the build quality that make the
WERU difference.
The WERU UK team have extensive
experience in managing bespoke new build
glazing projects and extensions of all sizes.
They provide detailed product information
and also advice on the best system and
styles to suit your property. They find that
many people do not fully appreciate the
huge variance in window and door systems.
Let them advise on the key benefits they feel
their products will offer you.
Triple glazed windows
Designer front doors
Panoramic sliders
Bifold doors
Glass rooms
Why not visit our superb showroom we are open 7 days a week
Amy Johnson Way, Blackpool FY4 2RP
T: 01253 341444 E: info@weru.co.uk
THE GEBERIT AQUACLEAN
THE TOILET THAT CLEANS YOU WITH WATER
Hygiene,
made easy
Cleanliness
without
compromise
The Geberit AquaClean Mera Classic is equipped with an impressive range of functions.
The Comfort model offers even more comfort functions.
WhirlSpray shower technology with
ive adjustable pressure settings
Seat heating
(available on the Comfort model)
Perfect hygiene is guaranteed by
the Rimfree® open flush pan design
User detection
Intuitive and clearly laid out remote control
Energy-saving function
Descaling function
TRADE PRICES | FREE CAD DESIGN SERVICE | FREE PARKING
DESIGNER BRANDS | 3 FABULOUS SHOWROOMS WITH 50+ DISPLAYS IN EACH
SHOWROOM OPENING HOURS: Monday-Friday 9am-5pm | Saturday 9am-4pm
Open each Bank Holiday Monday in May from 10am-4pm
MANCHESTER: Newton St, Stretford M32 8LS
0161 864 3610 | sales@atlasbathrooms.co.uk
WARRINGTON: 199 Warrington Rd, Penketh WA5 2RX
01925 720 220 | warr@atlasbathrooms.co.uk
Warrington showroom open until 8pm on Mondays
@atlasbathrooms
atlasbathroomsandtiles
HUDDERSFIELD: Victoria Mill Albert Street, Lockwood HD1 3QF
01484 547 110 | hudd@atlasbathrooms.co.uk
www.atlasbathrooms.co.uk
On trend
INTERIORS
Credit: Alexander von Berge
Credit: Jon Day
Accessorize @ therugseller.co.uk
FLAT OUT
GORGEOUS
P
arker Knoll’s latest collection,
evolution, combines the 149-year
old company’s latest motion
technology developments with a luxurious
contemporary aesthetic.
As part of the new collection, the
iconic Statesman chair (born in the late
1960s) has been re-launched. This new
$OWULQFKDPEDVHG5RVH*UH\FRQWLQXHWR
EULQJXVSHUIHFWO\SLWFKHGSLHFHVWKDWWDS
GLUHFWO\LQWRWKHPLGFHQWXU\PRGHUQWUHQG
WKDWZRUNVVRZHOOLQKRPHVRIHYHU\DJH
DQGVW\OH
)RU66WKHLUFROOHFWLRQLQFOXGHVWKLV
UDWKHUJRUJHRXVJUHHQEUDVVGLVSOD\
FDELQHWZKLFKZLOOVKRZFDVH\RXUVSHFLDO
ELWVDQGEREVLQHOHJDQWVW\OH$OVRNH\LQJ
LQWRDQLQFUHDVLQJO\LPSRUWDQWHOHPHQWLQ
URRPGUHVVLQJLVWKHLUQHZFROOHFWLRQRI
IDX[IORZHUVLQFUHGLEO\UHDOLVWLFERWKWR
ORRNDWDQGWRWKHWRXFKWKHFROOHFWLRQ
LQFOXGHVZLOGIORZHUVQHXWUDODQG
YLEUDQWO\FRORXUHGEORRPVDQGYHUVDWLOH
IROLDJH
model retains signature elements of the
chair’s design – such as the button-back
and wooden base, yet has all the
comfort demanded by a twenty-first
century customer. Form and function in
perfect harmony, we say.
arighibianchi.co.uk
Credit: Lee Garland
Mid-century now
Statesman chair
from Parker Knoll
Accessorize Home has launched its
first ever collection of rugs and each
of the 15 designs with the brand’s
signature hand-crafted, bohemian
edge and vibrant colours are utterly,
unmistakeably, Accessorize.
Design Director at therugseller.
co.uk, Daniel Prendergast says:
‘Known for its lively and colourful
fashion accessories, Accessorize
is a powerful and instantly
recognisable brand from the UK
high street. This new rug
collection is the brand’s first
venture into rugs and we’re
delighted to now offer them
within our portfolio.
‘Each rug has been exquisitely
hand-crafted in India, in-keeping
with the fashion retailer’s
commitment to bring vibrant,
artisan products from faraway
places to the UK high street.’
therugseller.co.uk
Credit: Robert Mantey
THE ART OF RECLINING
$WODQWLF6WUHHW$OWULQFKDP
URVHDQGJUH\FRXN
livingedge.co.uk
39
Why Fireplace Superstore?
Here’s 5 reasons you should buy from us!
Our own employed, in-house installation engineers – a one-stop shop
bring your
Largest live display of Chesney fireplaces and stoves
in the north of England
More than 110 fires and fireplaces held in stock,
enabling quick installation dates
TO LIFE
Free engineer surveys on every fireplace purchased,
ensuring suitability of the fireplace for your home
359 days a year same day/
next day call-out service
fireplacesuperstore.com
0161 488 4991
STANLEY GREEN RETAIL PARK \ EARL ROAD \ CHEADLE HULME \ CHEADLE SK8 6PT
Architecture and
design in perfect balance.
Visit our stunning showroom
for more inspiration
ArtHouse Creative Interiors
@ArthouseCreativeInteriors
57 London Road, Alderley Edge, Cheshire SK9 7DY 01625 581 313
info@arthousecreativeinteriors.co.uk www.arthousecreativeinteriors.co.uk
@Arthouse13
6-9 Hopkins Close, Greenfield Road, Back Lane, Congleton CW12 4TR
W
NO
E
L
SA
Please take
a look
ON
Quality you can trust
WHATEVER
YOUR LIFESTYLE
...WE HAVE
FLOORING
TO SUIT IT!
Chester
Stokers Fine
Furniture,
Sealand Road,
Chester CH1 4LT
t: 01244 377067
Llandudno
1 Mostyn Avenue,
Craig y Don,
Llandudno
LL30 1YS
t: 01492 877000
Manchester
184 Wilmslow Road,
Heald Green
SK8 3BH
t: 0161 8706672
e: carpets@linneycooper.co.uk I www.linneycooper.co.uk
With thousands of different designs available, customers are
sure to have the opportunity to select the exact floor covering
to match their taste and budget. Once you have made your
selection, the shop will send along it’s fully qualified carpet and
laminate fitters to complete the job.
Town & Country Carpets
153-155 Northenden Road,
Sale Moor, Manchester M33 2HS
Karndean
Specialists
0161 976 6887
ESTABLISHED OVER
25 YEARS
AWARD WINNING
CONTRACTORS 2017
BESPOKE DESIGN & BUILD IN CHESHIRE
The Vanderbyl team consists of our own in-house
designers backed by a friendly customer service
team and highly qualified operatives on site.
From refurbishments and extensions,
through to new builds, Vanderbyl ensure all
work is of the highest standards.
01625 441567
HAS YOUR
DOUBLE
GLAZING
STEAMED UP?
Established for over a decade
Cloudy2Clear windows have
become a leading company
for glass replacement
“Cloudy2Clear GUARANTEE All Customers That An
Average Quote Will Take No Longer Than 20 MINS!!!”
Bank House, The Paddock, Cheshire, SK9 3HQ
info@vanderbyldesign.co.uk | www.vanderbyldesign.co.uk
Issues with double glazing can
often be gradual and may only
be noticed during a clear
sunny day or during the
winter.
A failed glass unit may no
longer provide you with the
minutes. Once the quote is
completed, we will explain the
problem and tell you how we
can fix it. With years of
experience we have a wealth of
knowledge and are recognised
protection you need or be
energy efficient. You may think
as a Which Trusted Trader,
you need to replace the whole
window including the frames
industry leading 25 year
and all the hardware, however
Cloudy2Clear have come up
with a simple and cost saving
solution…Just replace the
glass!
plus our work is backed by an
guarantee.
Cloudy2Clear also replace
faulty locks handles and
hinges on all windows and
doors. Your friendly local
specialist is Richard and he
If you see condensation in your
windows just visit our website
or give us a call. We will send
out our highly experienced
engineers for a free no
obligation quote. A
Cloudy2Clear quote takes on
average no longer than 20
services the Cheshire area.
If your windows are
steamed up, broken or
damaged give Richard a
call for a free quotation
on 0800 61 21 118.
INTERIORS
A RTY K I DS
It’s never too soon to inspire a love of art and creativity in your child
HEAD IN
THE CLOUDS
Cloud hanging sculpture, from £150
chaplins.co.uk
44
livingedge.co.uk
LOVE
LAUGH
LIVE
Hello Sunshine poster, £35
Muumuru Metsanaapurit poster, £19.50
Giraffe fine art print, £25
bobbyrabbit.co.uk
zandersandsons.co.uk
loladesignltd.com
TO INFINITY...
Snurk Rocket duvet set, £49
beaumonde.co.uk
ARTISTIC
LICENSE
DAZZLE
Seascape of sea creatures and boats, £4.50-£85
Kokeshi Karl Lagerfield
wooden doll, £32.95
littlebabycompany.com
visionwithinart.com
STATEMENT ART
Go Away I’m Eating plate, £15
artwow.co
COME FLY WITH ME
Think Happy Thoughts framed print, £30
athenaart.com
KEEP FOREVER
Children’s artwork folder, £20
notonthehighstreet.com
livingedge.co.uk
45
Household Staff…
I
f you currently have someone working
within your home and you are not sure
whether they are considered to be your
‘Employee’ then you must read on….?
3, They generally work for more than
one client
4, They are in complete control of their own
business Profit and Loss account
Did you know that your worker is
considered to be your ‘Employee’ if the
following apply!!
1, They work regular hours and those hours
are set by you
2, They receive a regular payment from you for
the hours that they work without having to
submit an invoice for their services
3, They are not permitted to send someone
else to do their work
SO...
If you have someone working for you and
you really didn’t realise the implications of
Employment Law then now is the time to do
something about it!
The HMRC are stepping up their programme
of ‘Status Reviews, in order to determine
whether your staff are considered to be
employed by you.
Should this be the case, you need to be
made aware of your responsibilities as
their ‘Employer’.
If you are under the impression that your
worker is self employed but this review
decides otherwise then you could be liable
for any unpaid or underpaid tax contributions
ascertaining to the length of time that the
person/s have been in your Employ and it would
be highly likely that the ‘employee’ could also
pursue payment for already taken or yet to
Someone who is considered to be selfemployed must be able to show that:1, They have complete control over the times
in which they work and may send someone
else to carry out that work if it is in the best
interests of their business
2, They submit regular invoices to you for
payment of services
‘Employed’ or
‘Self-Employed’.
Good Question?
be taken holiday entitlement as well as other
benefits included in a Contract of Employment.
Did you know that as an ‘Employer’ it is your
duty to provide your worker/s with a Contract
of Employment and even if you fail to do this
they are still entitled to all the benefits of
that contract.
Enrolment into a Pension Scheme is now
compulsory for all workers even if you only
employ one person.
If all of this legal stuff sounds daunting
and has made you ‘stop and think’ about your
current staffing situation or, indeed, made you
consider how you intend to go forward when
considering taking on a new staff member in
the future then….
‘Worry no more’
Clockwork House have the perfect solution
for all your staffing requirements!
So… Don’t delay… Keep the tax man at bay
and call us today to discuss your individual
household needs…
WE RECRUIT • YOU SELECT • WE EMPLOY
OUR PEOPLE
YOUR DREAM
Enhance your property – both inside and out
Transform your home with a range of Window styles and see how
warm, cosy, and bright living spaces become.
For design ideas and expert advice visit us today. Step into the beautiful hardwood orangery and take a seat in
our stunning conservatories. We have four full-sized rooms for you to explore in our newly refurbished showroom.
Choose from our full range of replacement windows and doors in timber, aluminium and PVCu.
We are open 7 days a week so call in for coffee, talk to our experienced designers
and let us turn your house into your dream home.
T. 01625 858 800 17 London Road South, Poynton, Stockport, Cheshire SK12 1LA
NOW OPEN IN GLOSSOP: T. 01457 597 477 Peakdale Road, Brookfield Industrial Estate, Glossop SK13 6QL
www.crystal-living.co.uk
LSM
FLOORING
CARPETS
RUGS
VINYLS
WOOD FLOORS
AS SEEN
ON TV
Laser
Hair
Removal
at
dunham
consulting
D
unham Consulting has been established for
over 20 years. The clinic is set in an exclusive
and tranquil location in Altrincham, offering
complete privacy. We specialise in a variety of
treatments including laser hair & vein removal,
electrolysis, micropigmentation, wart removal
and many more. Our expert medical team offer
the latest cosmetic procedures.
LSM Flooring Suppliers and installers of quality loor coverings and fine carpets, across
Cheshire and Greater Manchester. We recommend leading loor manufacturers such as
Kahrs, Karndean, Pergo, Quick step, Cormar Carpets and many more all of which can be
found on display in our showroom. Come and visit our fantastic new showroom where
our helpful and friendly staff will be on hand to help you make the right looring choice.
0161 941 4974
2 Draybank rd next to Waitrose Altrincham
www.lsmflooringmanchester.co.uk
SCAN TO SEE
US IN ACTION
Free patch
test and
consultation
Nd:Yag laser
suitable for all
skin types
£34
per 10 minute
session
(laser hair removal
only)
0161 980 6688 | info@dunham-consulting.co.uk
www.dunham-consulting.co.uk
Goose Green
Summer Festival
PLACES
M Y A LT RINCH A M
Christopher Taylor is director at Gran T’s Coffee House in Altrincham.
Here he tells us why he loves to spend his days in this busy town.
Credit: Peter Barnett
My favourite …place to shop
$OWULQFKDPLVEOHVVHGWRKDYHPDQ\JUHDW
LQGHSHQGHQWVKRSVVXFKDVWKHQHZVW\OLVK
-DNHV6KRHV,ORYHWKHEX]]RIWKH0DUNHW
WRR:HDUHDOVRYHU\SULYLOHJHGKHUHZLWK
PDQ\JUHDWKLJKVWUHHWFKDLQVKDYLQJVKRSV
LQWKH6WDPIRUG4XDUWHUVXFKDV1H[WDQG
'HEHQKDPVZKLFKPHDQVWKHUH¶VQRQHHG
WRKHDGWR0DQFKHVWHU,W¶VJUHDWIRUDVPDOO
WRZQWRKDYHWKHVHEUDQGVDQGVRPDQ\
FKRLFHVRQLWVGRRUVWHS
My favourite…place to relax
$IWHUDKHDY\GD\RIZRUNZHDOOORYHWR
KHDGRXWIRUDFKHHN\3URVHFFRRUEHHUWR
6LQFHEHLQJLQ$OWULQFKDP,¶YHVHHQVRPDQ\
HYHQWVWDNHSODFHWKRXJKWKH\HDUVRLW¶V
KDUGWRVHOHFWRQHHYHQWWKDWVWDQGVRXWIURP
WKHUHVWLQVXFKDFUHDWLYHWRZQ$OWULQFKDP
RIIHUVVRPXFKIRUDOOWKHIDPLO\EXWDILUP
IDYRXULWHVRIDUKDVWRKDYHEHHQWKHSRVLWLYH
YLEHVIURPWKH*RRVH*UHHQ6XPPHU
)HVWLYDORUJDQLVHGE\$OWULQFKDP8QOLPLWHG
$OWULQFKDP¶V%XVLQHVV,PSURYHPHQW'LVWULFW
My favourite thing
about being in business
in Altrincham
My favourite…place to eat
7KLVLVDWRXJKRQH$OWULQFKDPKDVEHFRPH
DERRPLQJIRRGDQGGULQNKXEDQGZHDUH
QRWVWUXJJOLQJIRUFKRLFHIURPTXLUN\DQG
WDVW\LQGHSHQGHQWVWKURXJKWRWKHVDIH
RSWLRQRIWKHKLJKVWUHHWQDPHV2QHRIP\
SHUVRQDOIDYRXULWHVLVWKHUHFHQWRSHQLQJRI
7UH&LFFLRRQ0RVV/DQHVHUYLQJD
GHOLFLRXVFKRLFHRI,WDOLDQ5RDVW&KLFNHQ
DQG1HDSROLWDQSL]]DV$ELJWKLQJIRUPHLV
WKDWWKLVUHVWDXUDQWDOVRGHOLYHUVJUHDW
KRVSLWDOLW\IURPLWVWHDPDQGLWVVWXQQLQJ
RXWVLGHDUHDPDNHVLWWKHSHUIHFWVSRWWRHDW
KHDGLQJLQWRWKHVXPPHU
My favourite…local event
Christopher Taylor
XQZLQG$URXQGWKHPDUNHWP\IDYRXULWH
KDVWREH&RQ&OXEEXW,DOVRHQMR\
VRPHWKLQJPRUHFKLOOHGRXWDQGDZD\IURP
WKHKXVWOHDQGEXVWOH,ORYHWKHYLEHRIWKH
*RRVH*UHHQDUHD,WKDVVRPHJUHDW
RIIHULQJVIURPWKHIXQN\DQGUHIUHVKLQJ
7UDGHUV7LNL%DUWRDFKLOOHGEHHUIURP
5XVWLFZKLFKLVMXVWDURXQGWKHFRUQHURQ
6WDPIRUG1HZ5RDG
2SHQLQJDQHZEXVLQHVVLVDOZD\VDKXJH
VFDU\ULVN%XWWKHELJJHVWWKLQJWKDWKDV
JLYHQPHZDUPWKFRQILGHQFHDQG
UHDVVXUDQFHWKDWZHPDGHWKHULJKWFKRLFH
E\LQYHVWLQJLQ$OWULQFKDPKDVWREHWKH
ORYHDQGZHOFRPHWKDW*UDQ7¶V&RIIHH
+RXVHKDVUHFHLYHGIURPWKHORFDOVDQG
YLVLWRUVWRWKHWRZQ7KHVXSSRUWWKDWWKH
FRPPXQLW\JLYHVXVLVPLQGEORZLQJVRDV
DEXVLQHVVZHWU\RXUKDUGHVWWRJLYHEDFN
LQDQ\ZD\ZHFDQ
*UDQ7¶V&RIIHH+RXVH
6WDPIRUG1HZ5RDG$OWULQFKDP
JUDQWFRIIHHKRXVHFRXN
livingedge.co.uk
49
Create some memories on a
family adventure holiday
We have them all planned around the school holidays
In partnership with
Let us inspire you
Call us on O161 927 7177
sales@crestaworldtravel.co.uk
www.crestaworldtravel.co.uk
ALTRINCHAM BASEMENT & CELLAR
CONVERSIONS
Interior designer – triciacunninghaminteriors.com
Using only the best quality materials and products available with our specialist teams of installers,
Altrincham Basement & Cellar Conversions will take control and oversee the entire project through to completion,
including lighting, plumbing, all electrical work, damp proofing and membrane system.
We undertake a comprehensive service from initial survey to design, dealing with planning permission,
structural engineering services and building regulations. We can also offer a full decorating service.
101 Oakfield Street, Altrincham, Cheshire WA15 8HQ
Tel: 07770 661507 (Daytime) Tel: 0161 941 4414 (Evenings)
www.abcconversions.co.uk
as featured
on Sky Living
ALTRINCHAM
A LT R I N C H A M
HAS IT ALL
For independent specialists of every kind, look no further.
DESIGNS FOR LIFE
BY COTTAGE
ALTRINCHAM
BASEMENT AND
CELLAR
CONVERSIONS
$WUXHIDPLO\EXVLQHVVHVWDEOLVKHGLQ
ZHSURYLGHDIULHQGO\SURIHVVLRQDO
VHUYLFHDQGKDYHDOZD\VEHOLHYHGWKDWD
VDWLVILHGFXVWRPHULVWKHEHVWLQYHVWPHQW
LQRXUIXWXUHEXVLQHVV:HRIIHUDIUHHQR
REOLJDWLRQTXRWDWLRQVHUYLFHDQGDUHKDSS\
WRSUHSDUHSODQVRUZRUNIURP\RXURZQ
DUFKLWHFWXUDOSODQV
7LPSHUOH\_
FRWWDJHNLWFKHQVFRXN
CRESTA WORLD
TRAVEL
<RXUORFDOµJRWR¶IRUILUVWKDQGNQRZOHGJH
RIWKHZRUOG¶VPRVWH[FLWLQJFLWLHVUHPRWH
EHDFKHVDQGGHVWLQDWLRQVKRZHYHU\RX
ZDQWWRH[SHULHQFHWKHP2XUWHDPKDYH
DOOWUDYHOOHGH[WHQVLYHO\DQGKDYHORWVRI
WLSVDQGLGHDVWRKHOSHQVXUH\RXUKROLGD\
LVSHUIHFWLQHYHU\ZD\&RQVLGHUXVDVD
IRQWRINQRZOHGJHDQGHQMR\WKHVHFXULW\
RXUVXFFHVVIXO\HDUVRIWUDGLQJZLOO
RIIHU\RX
$OWULQFKDP_
FUHVWDZRUOGWUDYHOFRXN
Cresta World Travel
MYERSON
SOLICITORS
$QLQGHSHQGHQWODZILUPEDVHGLQ
$OWULQFKDPUHFHQWO\DZDUGHGPHGLXPODZ
ILUPRIWKH\HDUDWWKH0DQFKHVWHU/HJDO
$ZDUGV7KLVKLJKO\UHVSHFWHGILUP
VSHFLDOLVHVLQDYDULHW\RIEXVLQHVVDQG
SHUVRQDOODZVHUYLFHVDQGRIIHUVDQDFFHVVLEOH
KLJKTXDOLW\DOWHUQDWLYHWRFLW\FHQWUHDQG
QDWLRQDOODZILUPV0\HUVRQUHSUHVHQW
EXVLQHVVHVDQGLQGLYLGXDOVLQ0DQFKHVWHU
&KHVKLUHWKH8.WKH(8DQGEH\RQG
$OWULQFKDP_
P\HUVRQFRXN
$VVHHQRQ6N\+RPH/LYLQJ&KDQQHO
7KH\VD\µ'RQ¶WPRYHLPSURYH¶DTXDOLW\
EDVHPHQWFRQYHUVLRQUHDOO\GRHVPDNHWKH
SRLQW7KHFKRLFHLV\RXUVVWDWHRIWKHDUW
KRPHFLQHPDOLYLQJVSDFHEDURUJ\P
:HZRUNZLWK\RXIURPFRQFHSWWR
FRPSOHWLRQWRFUHDWHDVXFFHVVIXODQG
HOHJDQWOLYLQJDUHD7RYLHZFRPSOHWHGRU
RQJRLQJSURMHFWVSOHDVHFRQWDFWXV
_
DEFFRQYHUVLRQVFRXN
THE CINNAMON
CLUB
&HOHEUDWLQJ\HDUVRIIXQWKLV\HDUZH
DUHWKHJRWRYHQXHLQ$OWULQFKDPLI\RX
ZLVKWRSDUW\6SUXQJGDQFHIORRU
IDEXORXVOLYHPXVLFV\VWHPFRPSOHWHHYHQW
PDQDJHPHQWIRUDOO\RXUHQJDJHPHQW
SDUWLHVELUWKGD\VDQQLYHUVDULHVDQG
GLQQHUGDQFHV&KRRVHIURPDSHUVRQ
EDOOURRPRURXULQWLPDWHVSHDNHDV\DWWKH
WRSRIWKHEXLOGLQJ
%RZGRQ_
WKHFLQQDPRQFOXE
LSM FLOORING
Mysersons Solicitors
52
livingedge.co.uk
:HDUHDIDPLO\UXQEXVLQHVVWKDWZDV
HVWDEOLVKHGLQDQGZHSULGHRXUVHOYHV
RQRIIHULQJTXDOLW\IORRULQJDWDIIRUGDEOH
SULFHV/60LVDQDSSURYHGUHWDLOHUIRU3HUJR
ODPLQDWHIORRUVDQGWKHRQO\VXSSOLHULQWKH
&KHVKLUHDUHD:HRIIHUDIXOOILWWLQJVHUYLFH
IRUFDUSHWVYLQ\OVZRRGRUUXJV:HUHDOO\
KDYHLWDOO
$OWULQFKDP_
OVPIORRULQJPDQFKHVWHUFRXN
Designs for Life by Cottage
We offer Private
Evening Hire for special
occasions & Private
Movie Nights.
For enquiries on events please email
info@gran-t-coffeehouse.co.uk
Wide range
of teas, cakes,
home-made fresh
sandwiches
and smooth coffee.
am, WA14 1EB
29 New Stamford Road, Altrinch
.co.uk
Email: info@gran-t-coffeehouse
www.gran-t-coffeehouse.co.uk
Reusable mugs now av
ailable!
New primetime BBC property series
Are you and your partner
desperate to transform your home
but simply cannot agree how?
With top architects and cutting edge graphics
we can reveal your dream home now!
Nightmare hallway, awful kitchen, botched bathroom,
or a bigger problem?
We want to hear from you.
If you have a budget set aside and need help creating a breath-taking
new home in 2018, please send your name, contact number and a
brief outline of your project to:
house@remarkable.tv
Please note that Remarkable Television (the producers of the show) are not always able to respond to every
interested applicant. We will use any information provided by you for the purposes of selecting participants
for the programme, research for and production of the programme. We will only share information with the
commissioning broadcaster, our insurers and any independent contractors involved in the programme.
Photo: g-stockstudio / iStock / Getty Images Plus
LIVING EDGE
SUMMER
FASHION | BEAUTY | FUN
SUMMER FUN
A G R A N D D A Y O U T...
Getting out and about just seems so much easier when the sun is
shining. Plan yourself some summer fun.
W¶VQRVXUSULVHWKDW
KRUVHUDFLQJKDVORQJEHHQ
NQRZQDVµWKHVSRUWRI.LQJV¶
,W¶VQRWRQO\EHFDXVHRXU
PRQDUFK\KDYHDORQJDVVRFLDWLRQZLWKWKH
SDVWWLPHEXWEHFDXVHLWUHDOO\LVRQHRIWKH
JUDQGHVWGD\VRXW\RXFDQKDYHDQGRK
WKDWIHHOLQJZKHQ\RXUFKRVHQKRUVHFRPHV
LQILUVWSDVWWKHSRVW7KHWKULOORIWKHUDFH
LVWKHVDPHIRUHYHU\SHUVRQRQWKHFRXUVH
OHDSLQJXSDQGGRZQDQGVKRXWLQJ\RXU
KHDGRIILVSRVLWLYHO\GHULJXHXU$QGLW¶VWKH
SHUIHFWH[FXVHWRGUHVVXSDOLWWOH
7RKHOS\RXPDNHWKHPRVWRI\RXUGD\
RXWSLFNLQJWKHZLQQHUV&KHVWHU5DFHVKDV
ZRUNHGZLWK0DFDUWKXU*OHQQ&KHVKLUH
2DNVWRFUHDWHDUDFHJRHUVVW\OHJXLGH7KH
JXLGHEULQJVWROLIHWKHGUHVVFRGH
JXLGHOLQHVDFURVVDOODUHDVDQGHQFORVXUHVDW
&KHVWHU5DFHFRXUVHERWKFDVXDODQGPRUH
IRUPDOZKLOVWSURYLGLQJVRPHIDVKLRQDEOH
LQVSLUDWLRQZLWKVRPHFDUHIXOO\VHOHFWHG
HQVHPEOHVIURPWKHH[WHQVLYHUDQJHRI
IDVKLRQEUDQGVDYDLODEOHDW&KHVKLUH2DNV
,
FKHVWHUUDFHVFRXNFRQWHQW
VW\OHJXLGH
ELEMENTARY
In the beautiful Northumbrian
countryside a terrifying mystery and
a legendary nemesis await the
arrival of the world’s greatest
detective. When the wife of Doctor
Watson disappears, a desperate
quest to find her begins. Holmes
comes face to face with his greatest
fear at the hands of his mortal
enemy in this new tale of romance
and suspense. Join Chapterhouse
theatre company in what promises
to be one of the must-see
productions of the summer.
14 July, Dunham Massey
chapterhouse.org
A stylish day at the races
WIN! AFTERNOON TEA @ THE COURTHOUSE, KNUTSFORD
There’s nothing says English
summer’s day out like Afternoon Tea!
Afternoon Tea at The Courthouse, Knutsford
One lucky Living Edge reader could
win a fabulous Rose Bubbles Afternoon
Tea for Two, at Knutsford’s historic
Courthouse, now a stylish hotel and
restaurant.
Enjoy a traditional Afternoon Tea,
with loose-leaf tea or Jaunty Goat
Arabica coffee, macaron, fruit scone,
clotted cream, preserves and a
selection of sandwiches alongside
pretty chocolate and fruit sponge
cakes, accompanied by a Rose Bubble
Cocktail, a delicious mix of Prosecco
with rose petal liqueur and lavender.
To enter, simply answer the
following question:
What is the name of the restaurant
and bar at the Courthouse?
A Barristers
B The Lock Up
C Cell Block H
Submit your answer online at www.
livingedge.co.uk or send your answer on
a postcard, with full contact details
including your email address and
telephone number, by 4 June 2018 to:
Living Edge Courthouse Competition,
Archant, The Barn, Elms Farm, Hobb
Lane, Daresbury, Warrington WA4 5LS.
Terms & Conditions: Competition entrants must be aged 18 years or over and be UK residents. The winners will be the first correct entry drawn after the closing date of 4 June 2018.
The editor’s decision is final. The winner will enjoy a Rose Bubbles Afternoon Tea for Two at The Courthouse, Knutsford, WA16 0PB. Your prize can be taken Monday to Sunday, must
be pre-booked and must be taken before 14 December 2018. The prize is non-transferable and there is no cash alternative. Promotor: The Courthouse, Toft Road, Knutsford, WA16 0PB
| www.thecourthousecheshire.com. For Full Terms and Conditions, including details of opt out, please visit www.archant.co.uk.
livingedge.co.uk
57
New showroom
Store Street, Bollington
Cheshire SK10 5PN
t: 01625 466200
e: showroom@portraitpools.com
w: portraitpools.com
Voted SPATA National Pool Contractor Of The Year 2017
INTERIORS
SUMMER
LIVIN’
Inspiration abounds for making the most of summer,
whatever your garden style.
BORDER ART
FEELIN’ HOT,
HOT, HOT
Hot colours used in wild abandon
create a Mediterranean feel on even
the dullest of English days. Think
brightly coloured cushions and
throws, or make a serious
statement…
An herbaceous border packed with colour is
every gardener’s dream (though for some of
us it’s no more than an annual fantasy,
blown to smithereens by an utter lack of
gardening ability). Add some year round
interest with sculptural shapes in the form
of obelisks around which to drape climbing
plants, border art or creative bird feeders,
such as these zingy orange delights.
Chelsea bird feeder, £64
madebymoore.com
Banjooli outdoor armchair
by Moroso, £585
chaplins.co.uk
WEEDER’S DELIGHT
Fresh from the flower beds isn’t the time
to be collapsing on your beautiful outdoor
sofa. What you really need is a bench
that can take all the muck and dust you
can throw at it and still look good. This
pretty little bench is made using PE
bamboo, a lightweight material that
makes it far easier to move into sun or
shade than the traditional garden bench.
Hampstead bench in PE bamboo,
£285 gardentrading.co.uk
60
livingedge.co.uk
JJEWEL IN
THE CROWN
Oh, you just would, wouldn’t you? Don’t
restrict your garden furniture to the obvious,
if you have room to think outside of the
box. I just adore this example – and with its
purple cushions it’s so on trend too.
Jewel daybed, £4,999,
bridgman.co.uk
PRIMEVAL JOYS
Our love of fire is positvely
primeval, possibly a reminder
of our caveman past.
Thankfully these days fires
come without lurking sabre
tooth tigers, so you can roast
your marshmallows without
fear.
Dynasty fire pit, £1,499.99
gardenfurniturecentre.
co.uk
A PLACE JUST FOR YOU
Everybody needs somewhere to go for a few
moments of escape, so choose a spot and
make it your own with a chair just right for you.
Add a side table, a cool drink, a book and a cat
(okay, so the cat is optional) and relax.
Windsor armchair & footstool, £949
bridgman.co.uk
LIGHT THE WAY
Entertaining in the garden shouldn’t end
when the sun goes down, so carefully
planned outdoor lighting is a must.
Unless you’re ready for a major
landscaping exercise, solar lamps are an
excellent solution. Choose lamps that you
can move around according to the
occasion and the need, and don’t limit
yourself to the type that push into the
ground – overhead lighting is far
preferable in an eating area, for example.
Eva Solo SunLight pendant light,
£75 noxuhome.com
livingedge.co.uk
61
PEAR MILL
BEDS & FURNITURE
‘One of the largest independent bed stores in the country’
OPEN: MONDAY - SATURDAY 9.30AM - 5.30PM • SUNDAY 11AM - 4PM
www.bedsandbedroomfurniture.co.uk t. 0161 480 8670
Pear Mill Industrial Estate, Stockport Road West, Lower Bredbury, Stockport SK6 2BP
®
FUNKY, FEMININE & VERSATILE
OUTFITS FOR...
Chester Races,
the Derby,
Royal Ascot,
Henley Regatta,
and all those other
summer events you love.
COLLECTIONS INCLUDE:
Elie Tahari
Tory Burch
Marc Cain
St.John
M.Missoni
Perseverance London
Thurley
pH15
Paule Ka
SportMax
Diane von Furstenberg
Moschino Boutique
Chiara Boni
Hale Bob
Patrizia Pepe
Paul Smith
AND MORE
®
50A High Street, TARPORLEY,
Cheshire CW6 0AG
01829 733251 info@sibelle.co.uk
Visit www.sibelle.co.uk and sign up for blogs, news, and offers.
Like our Facebook page
www.facebook.com/si.belle.tarporley to receive updates and titbits.
Opening hours: Monday to Saturday 10:00–17:30 Evenings & Sundays by appointment
®
FASHION
DRESS TO
IMPRESS
It’s the summer season and that means one thing – a new outfit.
Janet Reeder picks out the dresses and accessories with the wow factor
RACE DAY
J by Jasper Conran fascinator, £75
debenhams.com
PINK FOR DRINKS
Cotton blazer, £675, and trousers, £355
escada.com
IT’S A WRAP
Gestutz wrap dress, £150
ON YOUR BLOCKS
coggles.com
Block heel, £179
ashfootwear.co.uk
MAXI STYLE
Embroidered maxi, £75
www.littlemistress.com
DAILY DELIGHT
Boutique Moschino
flared-cuff dress, £410
DAISY CHAIN
Handbag, £495
marc-cain.com
64
livingedge.co.uk
www.harveynichols.com
FEELIN’ HOT,
HOT, HOT
Pomodoro Tropical dress, £89.99
Crissan, Cheadle Hulme
crissanclothes.co.uk
CLASSIC
STYLE
Mulberry New Lily
shoulder bag, £395
johnlewis.com
ROSE
GARDEN
Floral dress, £225, and
matching jacket, £255
SMART FINISH
josephribkoff.com
Rejina Pyo double-breasted textured
blazer, £555
harveynichols.com
A SCARLET
WOMAN
Kioa drape maxi dress, £180
french
connection.com
BLUE FOR YOU
Slingbacks, £80
duneleondon.com
livingedge.co.uk
65
On trend
BEAUT Y
ISLAND LIFE
Lauren Simon
RHOC star loves
her new look
DXUHQ6LPRQRI5+2&IDPH
ODVWPRQWKFKRVHWRZRUN
ZLWK'U0DUWLQ.LQVHOODDW
KLV+DOHFOLQLFWRJLYHKHUVHOI
DFRQILGHQFHERRVWIROORZLQJKHUUHFHQW
GLYRUFH
µ/LNHPDQ\\HDUROGZRPHQ
IROORZLQJDGLYRUFH,ZDVORRNLQJIRUD
FRQILGHQFHERRVWEXWQRWDVXUJLFDOIDFHOLIW¶
/DXUHQVD\Vµ,¶PWRR\RXQJIRUDVXUJLFDO
IDFHOLIWEXWIHOW,ZDQWHGVRPHWKLQJPRUH
WKDQMXVW%RWR[ZKLFKUHDOO\GRHVQ¶W
DGGUHVVWKHDUHDVRIWKHIDFHZKLFK
FRQFHUQHGPHWKHPRVW6RKDYLQJ
GLVFXVVHGRSWLRQVZLWK0DUWLQ,GHFLGHGWR
KDYHWKHQRQVXUJLFDO6LOKRXHWWH6RIW
SURFHGXUH,WZDVUHODWLYHO\TXLFNDQGHDV\
DQG,¶PUHDOO\SOHDVHGZLWKWKHUHVXOWV,
MXVWORRNIUHVKHUDQGPRUH\RXWKIXOZKLFK
LQWXUQKDVPDGHPHIHHOPRUHFRQILGHQW
DJDLQ¶
'U0DUWLQ.LQVHOODH[SODLQVµ7KH
/
66
livingedge.co.uk
6LOKRXHWWH6RIWWUHDWPHQWXVHVGLVVROYDEOH
VNLQOLIWLQJVXWXUHVZKLFKDUHVSHFLILFDOO\
GHVLJQHGWRUHGHILQHWKHIDFHIRUWKRVH
ORRNLQJIRUUHGXFHGVDJJLQJDQGµMRZOLQJ¶
7KHSURFHGXUHLVSHUIRUPHGDIWHUWLQ\GRWV
RIORFDODQHVWKHWLFDUHXVHGWRQXPEWKH
VNLQDQGDQKRXUODWHUSURGXFHVDQ
H[WUHPHO\GLVFUHHWDQGQDWXUDOORRNLQJ
UHVXOWOHDYLQJWKHIDFHFRPSOHWHO\PRELOH,W
FDQEHXVHGWRWUHDWWKHPLGIDFHDUHDDV
ZHOODVWDFNOHWKHQHFNDQGEURZVWZR
DUHDVZKLFKDUHQRWRULRXVO\KDUGWRWUHDW
QRQ±VXUJLFDOO\RUZLWKRXWDIIHFWLQJIDFLDO
PRYHPHQW7KHOLIWLQJHIIHFWLVLPPHGLDWH
DQGGLVFUHHWZKLOHWKHUHLVDOVRDJUDGXDO
DQGQDWXUDOUHJHQHUDWLYHHIIHFWZKLFKKHOSV
LQFUHDVHWKHYROXPHRIKROORZDQGVDJJLQJ
DUHDVDQGUHVWRUHV\RXWKIXOVKDSHOLQHVVWR
WKHIDFHJUDGXDOO\WRDFKLHYHDFRPSOHWHO\
QDWXUDOORRNLQJUHVXOW¶
+DOH_UHHQKDQFHFRP
If anybody knows how to
glow in the sunshine and
warmth of summer, it’s
Rhianna, and her new
Beach, please! collection
for 2018 is a simply
gorgeous set of three
products that are all you
need for sensational skin.
Body Lava is a glorious
body luminizer in two
shades, Who Needs
Clothes? - a glowing
rose gold and Brown
Sugar - a lustrous
bronze. With its
addictive vanilla scent,
it’s set to be a wardrobe
staple this summer.
Perhaps the most fun
piece from this new
collection is the Fairy Bomb
Glittering Pom Pom, a huge plush
pom pom filled with smooth,
hyper-reflective glitter in a delicate
shade of rose gold, softly scented
with vanilla and coconut, for an
all-over body shimmer. Finally, no
summer body collection is complete
without a seriously beautiful kabuki
brush, perfect for face and body, for
the even delivery of both powder
and liquid shimmer. Oh, the
bliss of it!
Body Lava, £46, Pom
pom, £34 & Kabuki
brush, £30 Harvey
Nichols Manchester
Sun kissable
7RP)RUG¶VOLSFRORXUFROOHFWLRQIRU
VXPPHULVDGD]]OHRIPXOWLKXHGGHOLJKW
,QKLV8OWUD6KLQHFROOHFWLRQQHZOLS
LQQRYDWLRQPHHWVVFLQWLOODWLQJVKDGHVLQ
IXOORQLQWHQVHWREDUHO\WKHUHFRYHUDJHLQ
GHOHFWDEOHVKDGHV
*ORVV\FUHDP\DQGDGGLFWLYHDQ
LQQRYDWLYHOLSIRUPXODFRPELQHVWKUHHOLS
PXVWV±WKHHDV\RQHVWURNHDSSOLFDWLRQ
RIDOLSVWLFNWKHKLJKVKLQHJOHDPRIDOLS
JORVVDQGWKHULFKHPROOLHQWRIDOLSEDOP
)HDWXULQJOLJKWZHLJKWVLOLFDSRZGHUVIRUDOO
GD\VKLQHHDFKVKDGHFRPHVZLWKHYHQ
JORVV\DSSOLFDWLRQDQGDOLJKWZHLJKW
FRQGLWLRQHGIHHO
…6HOIULGJHV([FKDQJH
7UDIIRUG
THE EDGE
LOVES
‫ﱽﱼ‬
CHOOSE
HEDONISM
Initio, the perfume house that
launched the dazzling Carnal
Collection in 2017, have brought us
a new thrill – Hedonism – and their
latest scent, Rehab, delivers on its
promises of ecstasy, with bells on.
A wholly contemporary, unisex
fragrance, this exciting scent
leads with top notes of bergamot,
black pepper and raunchy
bourbon, before delivering a rich
heart of evocative lavender, sweet
coumarin and smoky tobacco.
Base notes of vetiver, cedarwood,
sandalwood and amber ensure a
rich, dark and sensual finish that
will linger on the skin and in your
smile for hours.
£195, exclusively at Selfridges
Stay hydrated
6LVOH\KDVODXQFKHGDµVXSHUSURGXFW¶GHVLJQHGH[SUHVVO\WR
UHGXFHGHK\GUDWLRQRIWKHVNLQDNH\IDFWRULQWKHDSSHDUDQFH
RIILQHOLQHVWLJKWDQGGXOOVNLQ
+\GUD*OREDO6HUXPERRVWVK\GUDWLRQDQGGHHSO\
TXHQFKHVWKHWKLUVWLHVWVNLQE\KHOSLQJLWWRUHVWRUHLWVHOIE\
PHDQVRILWVQDWXUDOK\GUDWLRQPHFKDQLVPVVXSSRUWLQJWKH
VNLQ¶VQDWXWDOIDFLOLW\WRWDNHLQZDWHUFLUFXODWHLWWKURXJKWKH
GLIIHUHQWVNLQOD\HUVDQGUHWDLQLWDVPXFKDVSRVVLEOH
%OXH$JDYH<HDVWH[WUDFWSURPRWHVWKHV\QWKHVLVRI
K\DOXURQLFDFLGLQWKHGHUPLVDQGUHSOHQLVKHVWKHK\GULFOD\HU
&DUREEHDQH[WUDFWDFWLYDWHVWKHV\QWKHVLVDQGUHQHZDORI
K\DOXURQLFDFLGLQWKHHSLGHUPLVDQGERRVWVWKHVNLQ¶VZDWHU
UHVHUYHV:LOGSDQV\H[WUDFWDFWVWRVWLPXODWHWKHV\QWKHVLVRI
DTXDSRULQWKHPHDQVE\ZKLFKK\GUDWLRQWUDYHOVWKURXJK
FHOOPHPEUDQHVDQGVRHQFRXUDJHVWKHFLUFXODWLRQRIZDWHU
ZLWKLQWKHVNLQDQGHGHOZHLVVH[WUDFWVXSSRUWVWKHVNLQ¶V
ZDWHUWLJKWQHVVDQGWKHUHE\UHGXFHVZDWHUORVV
6LVOH\+\GUD*OREDO6HUXP$QWL$JLQJ+\GUDWLRQ
%RRVWHU…VLVOH\SDULVFRXN
GET SMART
The next generation of Pro-Collagen
anti-ageing skincare with Smart
Technology has arrived. This
clinically proven overnight treatment
uses ground-breaking new Drone
Peptide Technology to target areas
of the face where stress shows
most. Together with a blend of
Padina Pavonica, Microalgae and
Wild Indigo Oligosaccharides, this
new formula from globally adored
beauty brand Elemis works
throughout the night to help restore
the natural balance to stressed skin.
Pro-collagen Overnight Matrix,
£145 elemis.com
livingedge.co.uk
67
THE FINEST THAI FOOD
BAR &
RESTAURANT
EXTENSIVE
BAR MENU &
COCKTAILS
FUNCTION
ROOM FOR
PRIVATE HIRE
AVAILABLE
• Sunday Buffet from 12-3pm
• Takeaway Service
WILMSLOW
The Kings Arms Alderley Road SK9 1PZ
ALTRINCHAM
15 Regent Road Altrincham WA14 1RY
SANDBACH
2-4 Crewe Road Sandbach CW11 4NE
01625 538877 | wilmslow@phanthong.co.uk
0161 9285808 | altrincham@phanthong.co.uk
01270 759955 | sandbach@phanthong.co.uk
On trend
FOOD
Roast Lamb & Hotpot @ The River Restaurant
HUEL UP
Huel, the wholly nutritionally
complete powdered food loved by
those seeking to support a
weightloss programme in a healthy
way, has launched the world’s first
nutritionally complete breakfast
cereal, Huel Granola. The Granola
comes in two varieties, Original and
Berry, and contains the ideal balance
of protein, carbohydrates, fats and
fibre that you need on a daily basis
– and only 9% sugar, all from natural
sources including brown rice syrup
and raw sugar cane. Try the Berry
variery with almond milk, it’s really
rather tasty! £4.95 huel.com
Tasting notes…The River Restaurant
7KH/RZU\+RWHOZDV0DQFKHVWHU¶VILUVW
ILYHVWDUKRWHOVR\RXPLJKWH[SHFWWKHLU
GLQLQJRSWLRQVWREHWRSQRWFK<RX¶GEH
ULJKWZLWKLWVWZR$$VWDUVDQGYLHZVDFURVV
6DQWLDJR&DODWUDYD¶V7ULQLW\%ULGJHVPDUW
\HWFRPIRUWDEOHGpFRUDQGH[FHOOHQWVHUYLFH
ZKLFKEDODQFHVWKHLQVWDQWDWWHQWLRQ\RX
ZDQWZLWKWKHKXPRXUDQGIULHQGOLQHVV\RX
H[SHFWIURP0DQFKHVWHUYHQXHVLWWLFNV
PDQ\YLWDOER[HVEHIRUHZHHYHQJHWWRWKH
PHQX
,WLVWKLVRIFRXUVHWKDWLVDOOLPSRUWDQW
DQGIRUVSULQJ([HFXWLYH&KHI$QGUHZ
*UHHQKDVFUHDWHGDFRQILGHQWDQG
ZHOOEDODQFHGQHZjODFDUWHPHQXLQVSLUHG
E\KLVEHOLHIWKDWILYHVWDUKRWHOLQGXOJHQFH
GHVHUYHVJHQHURXVVHUYLQJVRIIRQGO\ORYHG
FODVVLFGLVKHV+H¶VQRWZURQJ,KDYHWR
VD\
,QWKHPRVWFRVPRSROLWDQRIVHWWLQJV
VHDWHGLQDERRWKRYHUORRNLQJWKH
DIRUHPHQWLRQHGEULGJHDOOOLWXSDQG
UHIOHFWHGLQWKHULYHUEHORZZHZHUHIDFHG
ZLWKDUHDVVXULQJVHOHFWLRQRINQRZQ
FODVVLFVPL[LQJIDYRXULWHGLVKHVIURP
DFURVVWKHZRUOGZLWKSDUWLFXODUHPSKDVLV
RQ%ULWLVKVW\OH2XUZDLWHU7DPDVZDV
UHDG\ZLWKKLVUHFRPPHQGDWLRQVDQG
WKULOOHGWRVKDUHKLVRZQWKRXJKWVZLWKD
UHDG\DXGLHQFH0LNHSOXPSHGIRUDSHD
DQGKDPVRXSWRVWDUWHJJHGRQE\7DPDV
ZKRFOHDUO\UHFRJQLVHGDNLQGUHGVSLULW0\
RZQFKRLFHRI7ZLFH%DNHG/DQFDVKLUH
&KHHVH6RXIIOpZDVPHWZLWKDNQRZLQJQRG
DQGFRQJUDWXODWRU\VPLOH7KH
FRQJUDWXODWLRQVVKRXOGKDYHEHHQDLPHGDW
WKHFKHIKRZHYHUDVWKLVZDVDQDEVROXWH
WULXPSK
$VDPDLQFRXUVHZHFKRVHDVKDULQJ
GLVKRI5RVHPDU\5RDVW/HJRI/DPEZLWKD
/DPE+RWSRWDQG3LFNOHG5HG&DEEDJH
7KHURDVWODPEZDVVZHHWDQGWHQGHUDQG
FRRNHGSHUIHFWO\SLQNZKLOHWKHKRWSRW
ZLWKLWVOD\HURIEXWWHU\SRWDWRWRSSLQJZDV
DWULXPSK7KHWUDGLWLRQDODFFRPSDQLPHQW
RISLFNOHGUHGFDEEDJHZDVDEVROXWHO\
GHOLFLRXVWKLVPLJKWQRWTXDOLI\DVILQH
GLQLQJEXWLW¶VYHU\ILQHIRRGLQGHHGDQG
MXVWWKHZD\ZHOLNHWRGLQH
$VZHRUGHUHGRXUPHDOV7DPDVDVNHG
0LNHQRWPHQRWHLIKHZDVSODQQLQJRQ
WKH6WUHDPHG7UHDFOH6SRQJHIRUKLV
SXGGLQJDGYLVLQJWKDWQRWRQO\ZDVLW
IDEXORXVEXWWRRNPLQXWHVWRSUHSDUH
VRRUGHUQRZRUUHJUHWLWIRUHYHU0LNH
IROORZHG7DPDV¶DGYLFHDQGPLQXWHV
ODWHUZDVDYHU\KDSS\PDQLQGHHG0\
RZQFKRLFH/HPRQJUDVVDQG/LPH&UqPH
%U€OpHVHUYHGZLWKUDVSEHUU\VRUEHWZDV
H[TXLVLWHXWWHUO\GHOLFLRXV
:LWKSHUIHFWO\MXGJHGZLQH
UHFRPPHQGDWLRQVE\7DPDVWKHZKROH
H[SHULHQFHZDVUHDOO\UDWKHUZRQGHUIXO
WKHORZU\KRWHOFRP_
SPRING MENU
The Clink Restaurant at HMP Styal
has launched its new spring menu
and is now offering vegan options
for the first time. Try the shallot
tarte tatin with crispy leeks,
sprouting spring salad and beetroot
puree; followed by spinach-infused
pappardelle with wild garlic pesto,
courgette ribbons, shaved
asparagus, broad beans, toasted
pine nuts and fresh rocket; and
finish with a strawberry, mint and
coconut panna cotta with strawberry
gel, thyme infused honeycomb and
strawberry granita. Oh my..!
Other seasonal delights include
pressed guinea fowl and ham
terrine served with pickled baby
vegetables and soda bread
croutons; pan fried lamb rump
with slow cooked lamb shoulder
croquettes; and rhubarb trifle with
elderflower-soaked sponge,
custard ice cream, rhubarb jelly
and rose-infused cream. Oh my,
oh my..!
theclinkcharity.org/the-clinkrestaurants/styal-cheshire/
livingedge.co.uk
69
FOOD
MEET THE CHEF
Matt Lowry is Sous Chef at The Orangery. Boasting two AA rosettes, The Orangery at
The Spa Hotel offers modern British fine cuisine with a delectable lunch menu, inviting
afternoon tea and a deliciously decadent dinner choice.
7HOOXVDELWDERXW\RXUVHOI:KHQ
GLG\RXILUVWJHWLQWHUHVWHGLQ
FRRNLQJ"
,VXSSRVHLWDOOVWDUWHGIURPJURZLQJXSLQD
KRWHOLQ%ODFNSRROWKDWP\SDUHQWVDQG
JUDQGSDUHQWVUDQ)URPD\RXQJDJHP\
VLVWHUVDQG,ZHUHEHLQJZRNHQXSDWDP
HYHU\GD\WRKHOSP\JUDQGGDGDQG
JUDQGPDLQWKHNLWFKHQFRRNLQJWKHEDFRQ
DQGVDXVDJHVPDNLQJWKHWRDVWGRLQJWKH
GLVKHV,WDVDOOQRUPDOGD\WRGD\OLIHEXW
UHIOHFWLQJEDFNQRZ,KDYHVRPDQ\JUHDW
PHPRULHVRIEHLQJZLWKIDPLO\LQWKH
EXVLQHVV
+RZGLG\RXJHWVWDUWHGDVDFKHI"
,ZDVPDLQO\ZRUNLQJIURQWRIKRXVHXQWLO,
ZHQWWUDYHOOLQJDURXQG$XVWUDOLDLQ
RQDZRUNLQJYLVD,ZRUNHGIRUWKH
6KHUDWRQJURXSLQ3HUWKDQG%ULVEDQHDQG
WKDWZDVP\ILUVWWDVWHRIDSURIHVVLRQDO
NLWFKHQ,WKHQHQUROOHGLQWKH$XVWUDOLDQ
6FKRRORI+RWHODQG7RXULVP0DQDJHPHQW
WRDQGVWXGLHGDQGZRUNHGLQDVHDIRRG
UHVWDXUDQWLQ3HUWKIRUDIXUWKHU\HDUEHIRUH
UHWXUQLQJKRPH
Matt Lowry at work.
:KDWLV\RXUVLJQDWXUHGLVK"
+DUGWRVD\DVLW¶VDOZD\VFKDQJLQJEXWDW
SUHVHQWRQWKHPHQXZHKDYH7UHDFOH&XUHG
VDOPRQ%DE\%HHWURRWVDQG%XUQW2UDQJHV
:HVRXUFHWKHYHU\EHVWLQORFDODQG
VHDVRQDOLQJUHGLHQWVLW¶VDUHDOSDVVLRQRI
RXUV6RPHRIWKHLQJUHGLHQWVDUHHYHQ
JURZQRQWKHJURXQGVLQWKH9LOODJH
*DUGHQ
,IWKHUHZDVDQ\RQHRQWKHZRUOG\RX
FRXOGFRRNIRUZKRZRXOGLWEH"
(ULF&DQWRQD
)DYRXULWHPXVLFWRFRRNE\"
7KH%HDWOHV2DVLV7KH:KR7KH-DP
:KDWGR\RXGRWRUHOD["
6SHQGLQJWLPHZLWKP\ZLIHDQGFKLOGUHQ
HVSHFLDOO\DEURDG*RLQJWRWKHIRRWEDOO
OLVWHQLQJWRPXVLF
7KH6SD+RWHO5LEE\+DOO9LOODJH
5LEE\5RDG:UHD*UHHQ
/DQFDVKLUH3535
_ULEE\KDOOFRXN
:KDWGR\RXHDWDWKRPH"
&RWWDJHSLHVDOPRQGLVKHVNLQJSUDZQDQG
FKRUL]RSDVWD
:KDWLVWKHNLWFKHQLQJUHGLHQWQR
RQHVKRXOGEHZLWKRXW"
6DOW
Roast Fillet of Spring Lamb
70
livingedge.co.uk
:KDWZRXOG\RXHDWIRU\RXUODVW
PHDO"
/DPEGLQQHUURDVWSRWDWRHVFDXOLIORZHU
FKHHVHPLQWVDXFH
Goats Cheese Soufflé
DINING
|
BAR
|
SOCIAL
|
ROOMS
9/10
“It’s the excellent food that’s
the big draw at Allium”
The Telegraph, November 2017
in association with
Acclaimed chef Mark Ellis, two time representative for
the North West region on BBC’s Great British Menu brings you
Chester’s most exciting new dining experience!
FIS&H
FIZZ
FRIDAYS
S a t u r d ay 3 0 t h j u n e
at capesthorne hall
t i c k e t s a n d i n f o at
classicibiza.co.uk
FRIDAY
NIGHT
MADNESS!
WEDNESDAY
FRIDAY
THE BEST FISH & CHIPS
IN TATTENHALL
AND A GLASS OF FIZZ
FOR JUST £12
Available all day!
FANTASTIC HOUSE
PROSECCO
FOR JUST £20 A BOTTLE
From 5pm
TWO STEAKS WITH
ALL THE TRIMMINGS
AND A GLASS OF WINE
FOR JUST £30
10% OFF
YOUR FOOD BILL
when you quote
‘Chesire Life’
ADULTS £39.50 CHILDREN £17.50
b o x o f f i c e 012 8 3 8 41 6 01
FOLLOW US ON
Lynedale House, High Street, Tattenhall, Cheshire CH3 9PX
01829 771477
|
www.theallium.co.uk
On trend
FASHION
Credit: Craige Barker
ON TARGET
The annual campaign
presented by Breast Cancer
Now has launched and offers
something for every woman’s
style needs.
The exclusive range for
2018 has been hand-picked
by some of the high-street’s
best loved retailers, including
M&S, Debenhams, River
Island and Simply Be and
each piece in the collection
carries a minimum 30%
donation to Breast Cancer
Now during the six week
campaign, to help make
life-saving research happen.
Shop the Fashion Targets
Breast Cancer collection and
show your support
throughout May. As the
campaign says: Fashion isn’t
a label, it’s a statement,
make yours.
FASHION INITIATIVE
M
ulti-award-winning
Manchester Arndale
initiative, The Empty
Shop, has inspired generous
donations of two tonnes of
clothing to raise money for
local charities.
The clothing - which was
collected at the stylish drop
off point in the Upper Mall
of Manchester Arndale - has
been counted up, weighed
and taken to the Goodstock
by V•Inspired store at 6
Oxford Road. The sale of
the pre-loved clothing will
raise funds for this year’s
charity partners, V•Inspired
and Centrepoint, who both
directly help Manchester’s
young people.
V•Inspired is the UK’s
Goodstock by V. Inpsired
leading volunteering charity
for 14-30-year olds, helping
young people develop new
skills for employability and
personal development
through volunteering in their
communities. Centrepoint
works in Manchester
supporting vulnerable young
people who are homeless or
at risk of homelessness.
White sequin t-shirt, £20 @
River Island
Manchester first
Polka Dot swimsuit, £28,
Red Herring @ Debenhams
72
livingedge.co.uk
Credit: Duane Procop
Alana silver shoes, £25 @ Simply Be
$EHUFURPELH)LWFKZLOOEH
RSHQLQJLWVVHFRQG8.ORFDWLRQ
WKLV$XJXVWDWLQWX7UDIIRUG
&HQWUHEXWWKLVZLOOEHWKHILUVW
3URWRW\SHVWRUHLQWKH8.
7KHQHZ$EHUFURPELH)LWFK
VSDFHLVRQHRIHLJKWQHZ
SURWRW\SHVWRUHVRSHQHGE\WKH
EUDQGDQGRQO\WKHVHFRQG
LQWHUQDWLRQDOORFDWLRQ
7KHVSDFHZDVLPDJLQHGZLWK
WKHEHVWFXVWRPHUH[SHULHQFH
LQPLQGWKHOD\RXWLQFOXGHV
DFFRPPRGDWLQJIHDWXUHVVXFK
DVLQQRYDWLYHILWWLQJURRPV
ZLWKDPHQLWLHVGHVLJQHGWR
HQKDQFHWKHFXVWRPHU¶VPRRG
Abercrombie & Fitch
LQFOXGLQJVHSDUDWHFRQWUROVIRU
OLJKWDQGPXVLFDVZHOODVD
SKRQHFKDUJLQJGRFN6HOHFW
ILWWLQJURRPVDFWDVSULYDWH
VXLWHVWRDFFRPPRGDWHODUJHU
JURXSVRIIULHQGVDQGIDPLOLHV
WallStreet
Access | Anonyme | Byoung | Fransa
Crissan
Cheadle
Hulme
French Connection | ICHI | Inwear | Onjenu
Nu Denmark | Religion | Sandwich | Saint Tropez
23 High Street
Sandbach, CW11 1AH
01270 761594
8 Lawton Road
Alsager ST7 2AF
01270 883465
34 Hospital Street
Nantwich, CW5 5RP
01270 620015
0HQVZHDU
IRU6XPPHU
This summer we have a large range of smart style casuals
Blousons • Jackets • Knitwear • Trousers • Shirts
BEST SELLING ROBELL TROUSERS
Gina Bacconi | RABE | JUST WHITE
POMODORO | Habella
LEBEK | Michaela Louisa | OLSEN
MARBLE | KIRSTEN
SIZES 10 - 20
Beautiful outfits
for every occasion
&DLQRI+HVZDOO
187-193 Telegraph Road, Heswall, Wirral CH60 7SE
Main Telephone: 0151 342 1769
Shoe Department: 0151 342 7023
cain-of-heswall.co.uk
For ladies that feel let down by the High Street
23 Church Road, Cheadle Hulme SK8 7JD
0161 485 3154 | www.crissanclothes.co.uk
Open: 10am-5.30pm Mon to Sat
Free parking to rear of shop
Bringing back your natural,
confident and healthy smile with...
Teeth in One Day
Using the latest technology and
expertise, The Dental Academy
offers the perfect solution to missing
or failing teeth.
With more than 25 years’ experience in the
field of dental implants, the team at The
Dental Academy understands the impact
that total tooth loss can have on personal
confidence and quality of life.
The Dental Academy is at the forefront in
the advancement of, and investment in,
dental implants. The team’s dedication to
offering an alternative to wearing dentures
has seen a huge improvement in quality of
life for many patients.
The Benefits
fixed, permanent
• Totally
set of teeth
natural smile
• Life-like
covering the roof
• Nothing
of the mouth
solution for patients
• Perfect
who are losing teeth due
to gum disease
Often
dental
• implantsonlyarefourrequired
to
replace a full set of teeth
A new set of teeth, complete
and fitted all in one day in
a simple procedure, leaves
patients smiling confidently
and naturally once again.
Call us for an initial consultation at NO cost.
01925 740 510
Quote: CL0418
The Dental Academy Knutsford
Malt Street, Knutsford, WA16 6ES
Tel: 01565 757030 Fax: 01925 740005
Email: info@dentalacademy.co.uk
One of the biggest fears faced by people
who have lost, or are about to lose, all their
teeth is the prospect of being without any
teeth at all for a period of time. The “Teeth
in One Day” concept alleviates this fear.
Patients leave at the end of the day with a
full set of fixed teeth, a natural smile, and
growing confidence. They find themselves
looking forward to an immediately
improved quality of life – all in one day.
The Dental Academy, Daresbury Lodge
Chester Road, Daresbury WA4 5LR
Just off
J11
Tel: 01925 740510 Fax: 01925 740005
M56
Email: info@dentalacademy.co.uk
www.dentalacademy.co.uk
BEAUTY
L O V E .WA N T. N E E D .
Summer beauty must haves
SUN LOVER
The marvellous Dr. Murad brings us
a clinically-proven serum that visibly
reduces the appearance of dark
spots, age spots and
hyperpigmentation, enhances skin’s
radiance and brightens skin tone
instantly and over time.
£70, Rapid Age Spot
Correcting Serum, £70 John
Lewis Cheadle & Trafford
SAMBA INTO SUMMER
A positive cocktail of delights, Jo Malone
London Cattleya Flower Body Mist and
Tropical Cherimoya Cologne will have
you dancing in the streets.
Cattleya Flower body mist,
100ml £45 & Cherimoya cologne,
30ml £47
GOLDEN DAYS
The silky texture of this sunkissed
highlighter is enriched with Jojoba
oil, and thanks to the highlighting
pearls, gives the face instant and
buildable radiance.
£16.90 kikocosmetics.com
GARDEN OF EDEN
This nourishing formula deeply conditions to
replenish lost moisture, improve texture, add
shine, treat split ends and tame frizz to
restore hair to its best self.
Coco & Eve Like A Virgin™, £34.50
Harvey Nichols Manchester
SLEEP TO HEAL
Neom Organics brings us Perfect Night’s Sleep
Cleansing Balm, a a delicious combination of the
deeply relaxing Tranquillity™ fragrance and
highly nourishing, super oils including Almond
Oil, Shea Butter and Roseto repair and hydrate
your skin while you sleep.
£32, neomorganics.com
livingedge.co.uk
75
A UK first
Milan Sabic has brought state-of-the-art slimming technology SlimEcho
to the UK, and chosen to open his first clinic in Sale
M
ilan Sabic came to Manchester
from the Netherlands, where he
has chosen to launch SlimEcho,
the innovative slimming technology that has taken his home country by
storm, and may well do the same here.
“I moved to the UK last year,” he says,
“driven by my belief that this technology
will be as successful here as it has been
elsewhere in Europe already, especially
in the Netherlands, where it has gained a
passionate following.”
SlimEcho, the brand name Milan applies
to his UK business, uses a combination of
ultrasound and electrical stimulation to
trigger fat loss, tone muscle and tighten
the skin.
“I first learned of it though my sister,”
he says. “I was very sceptical initially, but
I saw how effective it was for her. I did
a lot of research and even undertook a
course myself, to check that it could actually deliver the results it promised, which it
did. I approached the company that had developed the technology to discuss distribution, the Netherlands was already covered,
but I was delighted, if quite surprised, to
learn that it hadn’t yet been picked up in
the UK. I really believe in it, so I decided
to make some big life change and bring it
here, as exclusive distributor.”
SlimEcho works on three levels: it triggers
fat loss; it tones muscles; and it tightens
skin. But how?
Milan explains: “It’s non-invasive, painless and absolutely safe. Ultrasound
waves excite the fat cells and trigger
them to release some of the fat they hold.
The electrical stimulation of the muscles
creates calorie burn. It’s effective for men
and women, regardless of their weight and
fitness levels. Clients come for varying
reasons - fat loss, reduction of cellulite,
increase of muscle strength, reduction in
skin laxity, all this is possible.
“At the first appointment we undertake a
biometric test, which measures the bio-impedance – or resistance – to a painless
electric current which is passed through
the body tissue. We use this to analyse the
composition of your body including total
body water, muscle and body fat. From this
we devise the programme that will most
efficiently deliver the results sought. It’s
a wholly bespoke treatment, designed for
each individual client.
“It’s important to say that this is not a
standalone slimming system. Our clients
understand that they need to commit to a
full course, with recommended treatments
twice weekly. Also, you need to commit to
lifestyle changes to support it and to main-
tain it. Even liposuction isn’t a permanent
fix – if you don’t change the way you live,
you’ll go back to square one.”
So that’s how it works, but how does it feel?
“It’s a tingling feeling, with slight muscle
contractions. It’s not at all uncomfortable. It
takes about an hour, so people tend to bring
a book, or their laptop. The first treatment
can have quite dramatic results: we take a
series of body measurements beforehand
and guarantee (or your money back) an
overall loss of at least two inches, though
most lose between four and ten inches that
first session.
“I have opened my own clinic here in
Sale, and plan to open more, but it’s also
a franchise opportunity for people seeking
to establish their own business, or for spas
and clinics, and I fully expect the technology
to travel across the UK.
“There are many technology-based slimming options available now, but this one is, I
think, the most pleasant and most effective
you can find. It really works!”
Dalton House, Cross Street,
Sale, M33 7AR
0161 973 4982
www.slimecho.co.uk
Trim. Tone. Tighten.
Transform.
Book today, Slim tomorrow.
New to the UK, SlimEcho is a non-invasive, fast, safe,
effective and painless treatment for men and women.
Most clients see an overall loss between four and ten
inches after the first treatment.
Dalton House, Cross Street, Sale M33 7AR
Book your first session today for just £35!
www.slimecho.co.uk
Course of 10 treatments £400
See and feel noticeable and immediate results!
0161 973 4982
EY BACK
ON
M If you don’t lose
at least two-inches
in your first
treatment
GU
ARANTEE
BEAUTY
BE YOUR BEST SELF
Our beauty specialists bring you skill, expertise and state-of-the-art technology.
CHURCH ROAD
DENTAL &
COSMETIC
:HDUHDQDZDUGLQJZLQQLQJGHQWDO
FOLQLFEDVHGLQ&KHDGOH+XOPH:HIRFXV
RQFRVPHWLFRUWKRGRQWLFLPSODQWDQG
JHQHUDOGHQWLVWU\7KLVPRQWKZHDUH
UXQQLQJVRPHYHU\VSHFLDORIIHUVRQ
EUDFHVLQFOXGLQJ…2)),QYLVDOLJQ
FRPSOLPHQWDU\ZKLWHQLQJWUHDWPHQWWR
KHOS\RXWRHQMR\\RXUQHZVPLOHDQG
IOH[LEOHSD\PHQWRSWLRQV3OHDVHYLVLW
RXUZHEVLWHRUFDOOWRDUUDQJH\RXUIUHH
FRQVXOWDWLRQ
&KHDGOH+XOPH_
FKHDGOHKXOPHGHQWDOFRP
COURTHOUSE
CLINICS WILMSLOW
5HIRUP\RXU\RXWK/LIWDQGWLJKWHQ\RXU
ZULQNOHVDQGVDJJLQJVNLQ:HFDQKHOS
WRUHVWRUH\RXU\RXWKIXOFRPSOH[LRQDQG
FXUYHV&RXUWKRXVH&OLQLFV:LOPVORZLV
WKULOOHGWRLQWURGXFHWKHXOWLPDWHVNLQ
OLIWLQJDQGWLJKWHQLQJWUHDWPHQW
8OWUDIRUPHU,,,VXLWDEOHIRUERWKIDFH
DQGERG\
:LOPVORZ_
FRXUWKRXVHFOLQLFVFRPRXU
FOLQLFVZLOPVORZ
Courthouse Clinics
MEDISPA WILMSLOW SLIMECHO
$WKHU:LOPVORZDQG+DUOH\6WUHHWFOLQLFV
DZDUGZLQQLQJDHVWKHWLFLDQ'U1\OD5DMD
RIIHUVDIXOOUDQJHRIDHVWKHWLFEHDXW\
WUHDWPHQWVDQGDGYDQFHGVNLQWKHUDSLHVIRU
WKHIDFHERG\DQGVNLQLQFOXGLQJWKH
UHQRZQHG8OWKHUDS\70VNLQOLIWLQJ
WUHDWPHQWWKH3RLQW/LIW0ODVHU353
GHUPDOILOOHUVDQG&RRO6FXOSWLQJ70IDW
UHPRYDOIRUWDUJHWHGZHLJKWORVV
:LOPVORZ_
GRFWRUQ\ODFRP
7ULP7RQH7LJKWHQ7UDQVIRUP6OLP(FKR
LVDQHZVOLPPLQJFOLQLFWKDWPDNHV
VOLPPLQJHDV\IRUHYHU\RQH$W6OLP(FKR
ZHXVHQRQLQYDVLYHXOWUDVRXQG
WHFKQRORJ\WRKHOS\RXDFKLHYHWKHERG\
\RXKDYHDOZD\VZDQWHG,I\RXGRQ¶WORVH
WZRLQFKHVGXULQJ\RXUILUVWWUHDWPHQW\RX
ZRQ¶WSD\DSHQQ\6RPHFXVWRPHUVORVH
LQFKHVRQGD\RQH&RPHYLVLWXVDQGEH
DPD]HGZLWKWKHUHVXOWV
6DOH__VOLPHFKRFRXN
RE-ENHANCE
78
livingedge.co.uk
Photo: scyther5 / iStock / Getty Images Plus
SlimEcho
/RRN\RXUEHVWZLWKRQHRI5H(QKDQFH¶V
DPD]LQJWUHDWPHQWV:KHWKHU\RXZDQWWR
ORRNVOLPPHU\RXQJHURUMXVWJHQHUDOO\
JRRGZHFDQKHOS2XUH[WHQVLYHUDQJHRI
WUHDWPHQWVLQFOXGHVFRVPHWLFGHQWLVWU\
GHUPDOILOOHUVDQGDQWLZULQNOHLQMHFWLRQV
6LOKRXHWWH6RIWŠ)XVLRQ)UDFWLRQDO
0HVRWKHUDS\PXOWLDZDUGZLQQLQJ
'HUPDOX[Š/('3KRWRWKHUDS\ERG\
VFXOSWLQJZLWK9HODVKDSHFKHPLFDOSHHOV
DQGYLWDPLQERRVWGULSV
_UHHQKDQFHFRP
Church Road Dental & Cosmetic
Hale Acupuncture Clinic
Established 2003
Incorporating threepoints sports acupuncture
It’s a little known fact that not all Acupuncture Practitioners are the same. Pam
Bescoby of Hale Acupuncture Clinic has been providing Traditional Chinese
Acupuncture for over 13 years.
A totally holistic approach
Needles aren’t just inserted ‘where it hurts’
■
Needling will be virtually painless
■
An experience of deep relaxation
If your previous experience of acupuncture sessions is not in line with the
above, chances are you probably haven’t had traditional acupuncture. Pam’s
passionate approach and reputation is now widely recognised by western
medical consultants, professional athletes and fertility experts.
■
■
Best Acupuncture Clinic 2017
Cheshire & Lux Excellence Award for
Muscular-skeletal Treatments North West England
Now at Pam’s Hale clinic
Contact the clinic for free confidential advice
07800 571809 www.hale-acupuncture.co.uk
2 Carr Road, Hale, WA15 8DX
Get an exclusive insight into the exquisite
beauty Julia Knightley provides to patients
wanting anti wrinkle treatments in
Cheshire, and learn more about what it is,
and how it could enhance your gorgeous
looks. Our highest quality, specialist, non
surgical cosmetic treatments, including
anti-wrinkle injections, dermal fillers and
fabulous vampire facials are available only
to those who know where to look in
Cheshire and Manchester areas.
Services:
Anti Wrinkle Injections
Skin Rejuvenation
Vampire Facials
Dermal Fillers
Skin Peels
Microdermabrasion
Thread Lifts (stitch lifts)
Full range of laser
treatments including hair
removal, tattoo removal
and thread vein treatment
Mention Living Edge to receive
three areas of anti wrinkle
treatment for just £175...
49 Station Road
Cheadle Hulme
Cheshire SK8-7AA
Tel: +44 (0) 161 485 8104
shhh@juliaknightley.co.uk
www.juliaknightley.co.uk
BUSINESS & COMMUNITY NEWS
HAPPY
ANNIVERSARY!
BID CHAIR
APPOINTMENT
Party at The Cinnamon Club
KH&LQQDPRQ&OXELQ
$OWULQFKDPFHOHEUDWHV\HDUV
RIPDNLQJSHRSOHKDSS\WKLV
\HDU+RXVHGLQVLGH7KH
%RZGRQ5RRPVEXLOWLQWKH
ZHOONQRZQORFDOMD]]FOXELVIDPRXVIRULWV
JLJVZLWK&OHR/DLQH+XPSKUH\/\WWHOWRQ
DQG*HRUJH0HOO\EXWLWDOVRSOD\VKRVWWR
VRXOIRONDQGFDEDUHWWRR%RDVWLQJWKH
ODUJHVWGHGLFDWHGVSUXQJGDQFHIORRULQ
&KHVKLUHLWVSHULRGEDOOURRPKDVGDQFH
WXLWLRQIRXUQLJKWVDZHHNHYHU\WKLQJIURP
PRGHUQMLYHWRVDOVD/DWLQDQGEDOOURRP
DQGWRFRPSOHWHWKHFRPPXQLW\IHHOKRVWV
7
WKUHHFKRLUVRQ:HGQHVGD\VIRURYHU
SHRSOHDQG$OWULQFKDP)LOP&OXEHDFK
PRQWKWRR
1HLO+XJKHVZKRRSHQHGWKHFOXELQ
VD\Vµ$VWURQJVHQVHRIFRPPXQLW\
UXQVULJKWWKURXJKHYHU\WKLQJZHGRIURP
VLQJLQJDQGGDQFLQJWROLYHPXVLF7KLV\HDU
6WD[RI6RXODUHGXHWRDSSHDUDVZHOODV6DG
&DIH6QDNH'DYLVDQG-HUHP\6DVVRRQ$W
ZHHNHQGVWKHYLQWDJHEDOOURRPLV
WUDQVIRUPHGWRKRVWVZHGGLQJVSDUWLHVDQG
GLQQHUGDQFHV,Q6HSWHPEHU7KH%RZGRQ
5RRPVZLOOKRVWLWVWKZHGGLQJZLWKORFDO
FRXSOH/L]]LH(GGW\LQJWKHNQRW¶
Ewen Miller, Managing Director of
award winning Calderpeel
Architects, has been appointed by
Altrincham Unlimited, Altrincham’s
Business Improvement District
(BID), as Chair of its Board. Ewen,
who also chairs the Royal Institute
of British Architects in the North
West, takes over from Martin Duff
who was in post for three years.
Ewen said: ‘Since moving to
Altrincham I haven’t looked back,
it’s a fantastic place to work and
has recently been voted the best
place to live in the North West.
I’m relishing the prospect of
leading the BID Board as we
develop a clear and ambitious
plan for the next stage of
Altrincham’s future.’
A new, high profile members networking
club will be launched in Manchester in June,
just in time for the World Cup. The
Manchester Sporting Club will be housed
inside the iconic Manchester Hall and will be
available for members to meet, conduct
business, network and relax, and will stage
a exclusive events featuring well-known
figures from sport and the business of sport.
Ian Stafford, the Founder and Chairman
Sponsored by Aticus Law
of Sporting Club Holdings Ltd, explains:
‘I always wanted to open in
Manchester… because of its huge
sporting heritage. We intend to bring the
best people to it as members or star
guests, to help create the right kind of
business for our members and, of
course, we must have some fun too. We
can’t wait to get started.’
manchestersportingclub.com
Photo: Carl Sukonik
Sports network
Marc Yaffe, Deepa Parekh, Ian Stafford,
Candice Wrigley & Ben Peppi
Wilmslow | Manchester
livingedge.co.uk
81
EDUCATION
T H E Y S H O O T,
THEY SCORE!
Credit: Jonathan Stewart
EEH\&ROOHJH0DQFKHVWHUKDV
ODXQFKHGDQLQQRYDWLYHQHZ
FRXUVHIRUDVSLULQJ
IRRWEDOOHUVLQSDUWQHUVKLS
ZLWK,QWHUQDWLRQDO+RXVH
7KHFROOHJHLVRIIHULQJVWXGHQWVZLWKD
SDVVLRQIRUIRRWEDOOWKHLQYDOXDEOH
RSSRUWXQLW\WRUHFHLYHDSURIHVVLRQDO
$
TXDOLW\IRRWEDOOH[SHULHQFHZKLOVWVWXG\LQJ
$/HYHOVRUWKH&RPELQHG6WXGLHV
3URJUDPPH
6WXGHQWVDJHGSOXVRQWKHQHZ
SURJUDPPHZLOODWWHQGDFDGHPLFFODVVHVLQ
WKHPRUQLQJZLWKDIRFXVRQVFLHQFHRU
EXVLQHVV7KLVZLOOEHIROORZHGZLWKIRRWEDOO
WUDLQLQJVHVVLRQVGHOLYHUHGE\H[SHULHQFHG
8()$TXDOLILHGFRDFKHVLQFOXGLQJ
H[SURIHVVLRQDOSOD\HUV
3ULQFLSDO/L](ODPFRPPHQWHGµ:H
XQGHUVWDQGWKHLPSRUWDQFHIRUDQ\VWXGHQW
ZDQWLQJWRSXUVXHWKHLUVSRUWLQJDPELWLRQV
WRHQVXUHWKDWWKH\JDLQWKHEHVWSRVVLEOH
HGXFDWLRQZKLFKLVZK\ZHDUHLQFUHGLEO\
H[FLWHGWRODXQFKWKLVLQQRYDWLYHFRXUVH¶
SHOWING ENTERPRISE
Five Lower Sixth students
at Alderley Edge School
for Girls attended the
University of Chester for
the Young Enterprise
Dragons’ Den event, in
advance of the county
showcase in April 2018.
The team created their
brand ‘Cooking with
Culture’, a cookery book
82
livingedge.co.uk
for children which takes
them on a journey around
the world – which was
pronounced the winning
idea.
The Dragons said that
the students had
developed a great
product was balanced
with a polished
presentation, with all
students involved in
answering the questions
put to them.
Mrs Balfour, Head of
Economics and
Business said: ‘The girls
were truly impressive
and I was very proud of
their professional
presentation and
teamwork skills.’
Credit: Bob Greaves
TOP PRIZE WINNERS
Once in a lifetime
6WXGHQWVDWD6KURSVKLUH&ROOHJHHQMR\HGD
RQFHLQDOLIHWLPHH[SHULHQFHZKHQWKH\
VDQJLQ6W3HWHU¶V%DVLOLFDLQ9DWLFDQ&LW\
ODVWPRQWK
0HPEHUVRI(OOHVPHUH&ROOHJH
&KDPEHU&KRLUDORQJZLWKVRPHPHPEHUV
RIWKHORFDOFRPPXQLW\LQWKHWRZQEHFDPH
RQHRIRQO\DVHOHFWIHZWRSHUIRUPLQWKH
KLVWRULFKRO\EXLOGLQJ7KHWULSZDV
RUJDQLVHGE\GLUHFWRURIPXVLFDWWKH
&ROOHJH7RQ\&RXSHDQGIROORZVD
SHUIRUPDQFHDWWKH5R\DO)HVWLYDO+DOOLQ
/RQGRQZKHQWKH\WRRNSDUWLQWKH
%DUQDUGR¶V<RXWK&KRUDO&RPSHWLWLRQ
A group of Sixth Formers from
Manchester High School for Girls has
beaten stiff competition from over 400
students by winning the ‘Outstanding
Delegation’ award at one of the
country’s largest Model United Nations
(MUN) student conferences.
Held at Haberdashers’ Aske’s Boys’
School in Hertfordshire, ‘HABSMUN’
simulated a real United Nations
meeting, and saw delegates from 32
schools represent different countries
and debate pressing issues from
youth mental health to cyber security.
Student Navya Sarwal said: ‘I am
really proud of our ‘Outstanding
Delegation’ award. I was also
delighted to win a ‘Best Delegate’
prize as I’ve been involved with
Model United Nations for three years.
I have been assigned to represent
countries such as Iran on women’s
rights issues and it’s easy to get
frustrated when policies don’t always
match your own personal opinion.
MUN and the research that is
required into each country’s
background has, however, helped me
realise that there are many different
viewpoints to an argument.’
A TRIUMPH
T
here have been no
shortage of
remarkable dramatic
performances in The
Grange Theatre over the 40
year history of the school,
and the school’s excellent
production of The Phantom
of the Opera was no
exception.
‘Just seen Phantom of
the Opera at Grange
Theatre Hartford,’
commented one theatre
goer. ‘What a talented
group of young people!’
The main roles were
taken by Year 10 student,
Sophie Akka - displaying
her remarkable vocal
range in the role of
Carlotta Guidicelli; Lower
Sixth Form student
Maisie Tipping delivered
the pure notes required in
the role of Christine; and
Will Prior gave an
excellent performance of
acting and singing in the
role of the brooding
Phantom.
With a cast, orchestra
and crew of over seventy
pupils, a host of staff
lending their expertise, a
magnificent set and
sumptuous costumes, it
was a production of truly
epic proportions, and one
far exceeding the
standards expected of a
school production.
livingedge.co.uk
83
Providing a platform
for academic and
personal success
ounded in 1884, Ellesmere is
a co-educational boarding
and day school which offers
students from Yrs 3-13 a
platform for academic success and
personal development. A wide ranging
curriculum and extensive activities
programme allows each student the
opportunity to advance in a range
of disciplines, whether in the Arts,
Music, Drama, Sport or to develop
leadership and entrepreneurial skills.
Ellesmere College treats every pupil
as an individual, and success is doing
the best you can; a philosophy that all
parents, pupils and staff recognise and
support wholeheartedly.
F
The Lower School (Yrs 3-8) provides an
environment which focuses on individual
needs, and helps children grow into
happy, secure and conident young
people. Students joining Middle School
(Yrs 9-11) enjoy a stimulating environment
with an extensive academic programme
and an even wider range of curricular
and co-curricular opportunities, and
through Yrs 12-13, students have a choice
of A levels, BTEC or the International
Baccalaureate Diploma.
For those who pursue the Arts,
Ellesmere is the only UK independent
school to hold the Arts Mark Platinum
Award, and for sports enthusiasts,
Ellesmere is one of only nine schools in
the world to be an accredited Athlete
Friendly Education Centre (AFEC).
This provides greater flexibility to
students trying to balance studies with
training and competition schedules.
With the national renowned Titans
Swimming Team, six other sporting
academies, and incredible state of the
art world class facilities, pupils can train
at every Olympic discipline.
At Ellesmere we believe that developing
the whole pupil is much more than just
passing examinations; a philosophy
which is paramount to the continued
success of nurturing our students.
Visit our Open Day on May 13th 1-4pm.
Co-ed 7-18 Day and Boarding
Ellesmere College
Open Day
Sunday 13th May
1pm-4pm
“We were impressed by the
pupils; ambitious, enthusiastic
and focused. Ellesmere opens
a lot of doors” - TATLER 2017
| Excellent GCSE, A-Level, BTEC and
International Baccalaureate Results
| Superb Pastoral Care
| Award-Winning Arts Provision and
Co-Curricular Education
| Extensive Travel Options
| Excellent Sporting Traditions with
7 World Class Sports Academies
| Generous Scholarships
| Innovative Careers
Partnership Programme
| Flexible Day and Boarding Options
To find out more and to
register please contact
our admissions team on:
01691 626 510
www.ellesmere.com
Ellesmere College, Ellesmere,
Shropshire, SY12 9AB
@ellesmerecoll
/EllesmereColl
ellesmere_college
Innsbruck in summer. Photo: Christof Lackner
TRAVEL
HEAD FOR
THE HILLS
If you’re looking for a weekend break that’s a little out of the ordinary,
beat a path to Innsbruck, says Kate Houghton
KDYHDFRQIHVVLRQWRPDNH
:KHQLWZDVVXJJHVWHGWKDW,
HQMR\DZHHNHQGLQ,QQVEUXFN
,KDGWRORRNLWXSWRILQGRXW
ZKHUHLWLV$XVWULDLWWXUQVRXW$JRUJHRXV
OLWWOHFLW\,QQVEUXFNLVVHWLQWRWKHERWWRP
RIDYDOOH\KDVVQRZFDSSHGPRXQWDLQVRQ
DOOVLGHVDQGLVXWWHUO\GHOLJKWIXO
,ZHQWRYHULQWKHGHHSPLGZLQWHUMXVW
DVWKH&KULVWPDVPDUNHWVRSHQHGDQGWKH
VQRZZDVIUHVKRQWKHPRXQWDLQV\HWWREH
FXWE\WKHWUDFNVRIKDSS\VNLHUV,QQVEUXFN
KDVEHHQDKRWVSRWRIZLQWHUVSRUWVIRU
,
86
livingedge.co.uk
GHFDGHVWKHKRPHRIWZRZLQWHU2O\PSLFV
DQGRI%HUJLVHO6NL-XPSVWDGLXPDQ
DZHLQVSLULQJYHQXHGHVLJQHGE\DUFKLWHFW
=DKD+DGLGZKLFK\RXFDQYLVLWDQGIHHO
VHULRXVO\LQDZHRIWKRVHQXWWHUVZKRIOLQJ
WKHPVHOYHVRIILW
,ZDVDQWLFLSDWLQJVKDUSDLUDQGFOHDU
EOXHVNLHVWKHVSDUNOHRIIDLU\OLJKWVDQGORWV
RIZDUPJOXKZHLQ,ZDVQRWGLVDSSRLQWHG
7KHUHZDVDZKROHORWPRUH,KDGQ¶W
DQWLFLSDWHGKRZHYHUZKLFKDOODGGHGXSWRD
MDPSDFNHGZHHNHQGRIGLVFRYHU\
)LUVWOHW¶VWDON&KULVWPDVPDUNHWV
7KHVHDUHWKHUHIRUWKHZHHNVOHDGLQJIURP
1RYHPEHUXSWLOO&KULVWPDVDQGWKHFLW\
VPDOODVLWLVERDVWVVL[GLVWLQFWPDUNHWV
7KHPRVWFHQWUDOLVWREHIRXQGLQWKH2OG
&LW\LQDSUHWW\VTXDUHXQGHUWKH*ROGHQ
5RRIZKHUHDURXQGVWDOOVVXUURXQGD
WUXO\YDVW&KULVWPDVWUHHVKLPPHULQJZLWK
JROGHQOLJKWV,KDGDPDUYHOORXVWLPH
VWRFNLQJXSRQXQXVXDO&KULVWPDV
GHFRUDWLRQVKHUHQRWWRPHQWLRQILOOLQJXS
RQFODVVLFGLVKHVVXFKDV.DVVSDW]LQVPDOO
HORQJDWHGGXPSOLQJVLQDFKHHV\VDXFHZLWK
DGUHVVLQJRIFULVS\IULHGRQLRQVDQG.LDFKO
Photo: Christof Lackner
DGHHSIULHGSDVWU\GLVNVHUYHGZLWKDKXJH
GROORSRIVZHHWFUDQEHUU\MDP$GGDPXJ
RIKRWZLQHDQG\RX¶GWKLQN\RX¶GEHGRQH
IRUWKHQH[WKRXUVEXWWUXVWPHLW¶VMROO\
FROGVHULRXVO\LW¶VIUHH]LQJVRSDFNPDQ\
PDQ\OD\HUVDQGVWRNLQJWKHLQWHUQDOILUHV
ZLWKFDUEVDQGDOFRKROLVVRPHWKLQJWKRVH
7LUROHDQVNQRZKRZWRGRYHU\ZHOO
)RUIDPLOLHVWKHPDUNHWRQWKHULYHU
RIIHUVIDLUJURXQGULGHVWR\VVWDOOVSXSSHWV
WKHDWUHDQGVWRU\WHOOLQJDQGDTXLWHVWDUWOLQJ
6ZDURYVNL&KULVWPDVWUHHDVKHHUJORU\RI
VSDUNOHVDQGVKLQLQJOLJKWV<RX¶OOILQGD
µPRGHUQ¶PDUNHWLQFHQWUDO0DULD7HUHVHQ
6WUDVVHRIIHULQJDUWDQGXQXVXDORQHRII
JLIWVSOXVDZKROHIRUHVWRIFU\VWDOWUHHV
7DNHWKHIXQLFXODUDQRWKHUJORULRXVGHVLJQ
IURP=DKD+DGLGXSWR+XQJHUEHUJIRU
GD]]OLQJYLHZVDFURVVWKHFLW\DFFRPSDQLHG
E\PRUHKRWZLQHRUFKRFRODWHLI\RXVR
ZLVKDQGRQHRIIGHOLJKWVIURPORFDO
DUWLVDQV
,W¶VTXLWHSRVVLEOHWRSDVVDQHQWLUHGD\
DWWKHPDUNHWVEXWWKDWZRXOGEHDVKDPH
DVWKHUH¶VDORWPRUHWRWKLVFLW\WKDQEDXEOHV
DQGJOXKZHLQ
6ZDURYVNLZDVIRXQGHGLQ,QQVEUXFNLQ
E\'DQLHO6ZDURYVNLDFU\VWDOJODVV
FXWWHUZKRQHHGHGWKHFROGIUHVKZDWHU
FDVFDGLQJIURPWKHPRXQWDLQVIRUKLVZRUN
2YHUWKHGHFDGHVKHPRYHGZLWKWKHWLPHV
FKDQJLQJKLVFRPSDQ\¶VEXVLQHVVWRPHHW
FKDQJLQJPDUNHWGHPDQGVILQDOO\VHWWOLQJ
RQWKHIDEXORXVFU\VWDOVZHDOONQRZWKHP
IRUDQGRSWLFDOOHQVHVZKLFKZHGRQ¶WNQRZ
WKHPIRU,QWKH\FHOHEUDWHGWKHLU
\HDUDQQLYHUVDU\ZLWKWKHFUHDWLRQRIWKHLU
DVWRQLVKLQJO\EHDXWLIXO&U\VWDO:RUOG,W¶VD
OLWWOHELWPXVHXPDQGDQDZIXOORWDUW
LQVWDOODWLRQZLWKDVHULHVRIµURRPVRI
ZRQGHU¶OHDGLQJRQHIURPWKHQH[WDQGDOO
GHVLJQHGE\FRQWHPSRUDU\DUWLVWVXVLQJ
6ZDURYVNLFU\VWDOV)URPWKHPLQGEORZLQJ
NEED TO K NOW …
Drink Schnapps @ derbogner.at. Call to
book on 00 43 512 535 60
Be blown away @ kristallwelten.
swarovski.com
Get cultural @ schlossambrasinnsbruck.at
Develop vertigo @ bergisel.info.en
Learn more @ Innsbruck.info/en
Plan your itinerary and arrange travel
with Altrincham’s Cresta World Travel.
0161 927 7177 | crestaworldtravel.
co.uk
One of six Christmas Markets
3DODFHRI/RYHIURP0DQLVK$URUDWRWKH
LQFUHGLEOH&U\VWDO'RPHZLWKLWVPLUURUV
LW¶VDQLQFUHGLEOHMRXUQH\7KHUH¶VDQRXWGRRU
SDUNWRRZLWKWKHVSDUNOHVWKHPHUXQQLQJ
WKURXJKRXWDQGDUHDOO\YHU\JRRGOLWWOH
UHVWDXUDQW,W¶VDQDEVROXWHPXVWGR
$IWHUWKHGHOLJKWIXOGD]]OHRI6ZDURYVNL
DQGDJUHDWOXQFK,KHDGHGEDFNWR
,QQVEUXFNFXULRXVWROHDUQPRUHDERXWWKH
FLW\¶VPRUHDQFLHQWKLVWRU\,QQVEUXFNUHDOO\
ZDVWKHFHQWUHRIWKLQJVIRUTXLWHVRPH
ZKLOHLPSRUWDQWVLQFH5RPDQWLPHVDVD
WUDGLQJSRVWWKLQJVUHDOO\QRWFKHGXSDJHDU
RUWKUHHLQWKHWKFHQWXU\ZKHQWKHFLW\
EHFDPHDFHQWUHRI(XURSHDQSROLWLFVDQG
FXOWXUHDV(PSHURU0D[LPLOLDQ,WRRNXS
UHVLGHQFHKHUH+LVSUHVHQFHLVEHVWVHHQLQ
WKH+RINLUFKHZKHUHWKHUHLVWKHVWDUWRID
IXQHUDOPRQXPHQWIRU0D[LPLOLDQWKDWLV
TXLWHWKHVWDWHPHQWDERXWKLVVHOIHVWHHP
,W¶VQRWILQLVKHGKLVGHVFHQGDQWVGHFLGHGWR
VSHQGWKHPRQH\HOVHZKHUHXQVXUSULVLQJO\
,Q)HUGLQDQG,,$UFKGXNHRI
$XVWULDEXLOW6FKORVV$PEUDVZKLFKLVZHOO
ZRUWKDYLVLWQRWOHDVWIRULW¶VH[WUDRUGLQDU\
&KDPEHURI$UWDQG:RQGHUDQHFOHFWLF
FROOHFWLRQRILWHPVUHIOHFWLQJWKHHQWLUHERG\
RINQRZOHGJHDYDLODEOHGXULQJWKH
5HQDLVVDQFHHUDIURPDUWWRVFLHQFHWR
QDWXUHLQFOXGLQJZKDWZRXOGKDYHEHHQ
WHUPHGµIUHDNV¶DWWKDWWLPH6HULRXVO\
%DUQXPFRXOGKDYHOHDUQHGDORWIURP
)HUGLQDQG,,7KHUH¶VDOVRWKHEUHDWKWDNLQJ
6SDQLVK+DOODWUXO\VWXQQLQJVSDFHILOOHG
ZLWKOLJKWDQGFRORXUDQGWKHYHU\EHVWWKDW
WKHDUWLVWVRIWKHWLPHFRXOGSURGXFH<RX¶OO
EHXQDEOHWRDYRLGGUHDPVRIEDOOJRZQVDQG
VWULQJRUFKHVWUDVIURPWKHPRPHQW\RXVWHS
WKURXJKWKHGRRUV
1RYLVLWWRWKH7LUROLVFRPSOHWHZLWKRXW
DOLWWOHGDEEOHLQWRWKHLUPRVWIDPRXVH[SRUW
VFKQDSSV:KRNQHZLWFDPHLQDZKROH
PXOWLWXGHRIIUXLW\IODYRXUV"7KHEHVWZD\WR
OHDUQDERXWDQ\WKLQJQHZLVVWUDLJKWIURP
WKHKRUVH¶VPRXWKVRVLWWLQJGRZQRYHUD
SODWWHURIORFDOPHDWDQGFKHHVHDQGZRUNLQJ
\RXUZD\WKURXJKWKHHQWLUHFROOHFWLRQRID
ORFDOGLVWLOOHUKLFZKLOHKHWHOOV\RXDOO
DERXWLWLVDQH[SHULHQFH,ZRXOGPHUULO\
SXQLQWHQGHGUHSHDW6SHQGDQHYHQLQJ
ZLWK+XEHUW6WUDVVHUDWKLVGLVWLOOHU\VHWLQ
WKHIDPLO\¶VIUXLWRUFKDUGVZKLFKWKH\KDYH
IDUPHGVLQFHZKHUHZLWKRQO\RQH
VPDOOFRSSHUSRWKHPDNHVDZKROH
FROOHFWLRQRIIUXLWVFKQDSSVIURPWUDGLWLRQDO
SOXPWRDSULFRWFKHUU\VWUDZEHUU\DSSOH
DQGPRUH1RWWRPHQWLRQZKLVN\DQGJLQ
ERWKRIZKLFKKDYHZRQDZDUGV
$YLVLWLQZLQWHULVDGUHDPRIVQRZ
VKRSSLQJDQGVFKQDSSVEXWDYLVLWLQ
VXPPHULVDEVROXWHO\RQP\OLVWRIWKLQJVWR
GR7KLVLVDUHDOO\EHDXWLIXOFLW\WKDWWDNHV
OHLVXUHWLPHYHU\VHULRXVO\DQGVLWWLQJ
RXWVLGHDFDIpVLSSLQJFRIIHHDQGGLQLQJRQ
6DFKHUWRUWHZKLOHOLVWHQLQJWRDQRSHQDLU
FRQFHUWKDVKXJHDSSHDO
$QGDQRWKHUYLVLWWRWKH6FKQDSSVPDQ
RIFRXUVH«
The jaw-dropping Spanish Room @ Schloss Ambras
livingedge.co.uk
87
T
H
R RE LA
EM E S
T
A HO
IN
IN ME
G S
A V A I L A B L E F O R I M M E D I A T E O C C U P A T I O N,
N O W W I T H C A R P E T S I N C L U D E D
Arranged in a traditional courtyard, these superb two storey, four bedroom semi-detached homes
provide beautiful family accommodation in the heart of the Cheshire countryside.
SELLING AGENTS
Tel: 01625 585905
www.andrewjnowell.co.uk
Tel: 01565 757000
www.srushton.co.uk
www.phph.co.uk
LIVING EDGE
P RO P E RTY
Arthog Road, Hale | Gascoigne Halman, Hale
Heart safe
Buyers’ aid
A healthy
investment
A guide to happy
homebuying
livingedge.co.uk
89
BR E AT H TA K I NG N E W HOM E S I N A S T U N N I NG LO C AT ION
Alderley Park is an exclusive new residential enclave set within
Visit our on-site Sales and Marketing Suite to ind out
more and arrange a tour of these unique developments.
400 acres of beautiful Cheshire parkland, offering 74 luxurious
homes over three distinctive developments.
Opening hours are
Monday to Friday
from 9am to 5.30pm,
Saturday from 9am
to 5pm and Sunday
With a range of top-class facilities all on-site and the nearby
social hub of Alderley Edge, Alderley Park promises a lifestyle
that’s sure to make it the region’s most sought-after place to live.
from 10am to 5pm.
01625 586 130
Ph Homes
alderleypark@phph.co.uk
P h C o u n t r y Ho m e s
P h P r i vat e C L I E N T
www.phph.co.uk
•
P h M A L LOR C A
PROPERTY
Phil Spencer
A MOVING
JOURNEY
Lesley Appleton and Sarah Sanderson
Heart safe
DQFKHVWHUEDVHG3ULQFLSDO
&RQWUDFWRU0F*RII
&RQVWUXFWLRQKDV
FRPPHQFHGD
FRPSDQ\ZLGHVWUDWHJ\WREHFRPHDKHDUW
VDIHEXVLQHVV
2QVLWHGHILEULOODWRUVKDYHEHHQ
SXUFKDVHGE\WKHFRPSDQ\IRUWKHLU
+HDG2IILFHLQ$OWULQFKDPDQGWKHLUWZR
ODUJHVWFRQVWUXFWLRQVLWHVDQGWKH\DUH
ZRUNLQJLQSDUWQHUVKLSZLWKORFDO
0
New homes boost
Almost 1,200 new Redrow homes are
planned across four North West sites as
the homebuilder looks to expand its
business, including 850 new homes on a
77 acre site adjacent to its divisional
headquarters in Daresbury, near
Warrington. As part of its plans, Redrow
FKDULW\+DQGRQ+HDUWWRGHYHORSD
VWUDWHJ\WKDWZLOOXOWLPDWHO\HQVXUHWKDW
HYHU\0F*RIIVLWHLVKHDUWVDIH
7KHFKDULW\ZLOODOVREHZRUNLQJZLWK
0F*RII&RQVWUXFWLRQWRLGHQWLI\VFKRROV
QXUVHULHVDQGFRPPXQLW\JURXSVWKDW
DUHORFDOWR0F*RII¶VFRQVWUXFWLRQVLWHV
DQGZKRQHHGDVVLVWDQFHZLWKWKHLU
GHILEULOODWRUIXQGLQJ7KHVLWHWHDPVZLOO
WKHQIXQGUDLVHZLWKDYLHZWRSXUFKDVLQJ
DQGGRQDWLQJRQHWRDORFDOFDXVH
will be investing £8.5million in the
community; including the creation of a new
local centre, highway and public transport
improvements, open space provision and
affordable homes.
The award-winning homebuilder also
has plans for a new phase of 107
homes at the flagship Woodford Garden
Village project, plus an additional 77
homes in Sandbach.
There seems to be a continuous stream
of stories on spiralling UK house prices
and the affordability issues this has
created in many parts of the country.
Aware of this issue and the pressing
need to help buyers get the very best
deal when they are moving home, TV
celebrity and property expert Phil
Spencer has just launched a website
dedicated to supporting homebuyers to
make the move with confidence.
Phil says: ‘While the government
does appear to be addressing some
of the headline issues, I nonetheless
continue to receive a steady stream
of queries at a practical level asking
how to solve an array of problems in
a property transaction and how to
move stress-free. It’s because of this
I’ve launched Move iQ.
‘The website is deliberately
structured setting out a moving
journey through all the key stages of
moving – from where to live in the
first place to making a house a home
once you have found the perfect
property. This enables anyone buying
or renting to identify with their
current position and obtain the advice
and guidance they need for the exact
stage they are at. It’s an A-Z guide on
how to move and indeed what to do
if things don’t go quite to plan.’
Redrow plans to build 1200 new homes
livingedge.co.uk
95
Lodge Living Simply Got Better.
The Valarian, The Pastures, Cartmel.
52 WEEK
OCCUPANCY
BEAUTIFUL VAULTED CEILINGS AND QUALITY FITTINGS SOLID INSULATED WALLS, FLOORS AND CEILINGS
TRIPLE GLAZED WITH SHUTTER BLINDS PARKING FOR MULTIPLE CARS BUILT BY LOCAL TRADESMEN £285,000 ON A 99 YEAR LEASE
O PEN DAY V I E W I N G O R B Y A P P O I N T M EN T
As you stroll from room to room its hard to imagine you are in a lodge. The Valarian is a beautiful cedar clad lodge that sits in its
own private woodland with all round fabulous views from the extensive decking. The lodge measures 65 feet by 22 feet and is
just a two minute drive to the beautiful village of Cartmel. For more information please call Helen or Rachel on 015395 34252.
Or email helen@the-pastures.co.uk, rachel@thepastures.co.uk
The Willows on The Pastures at Cartmel LA11 7QY.
Going Call us
through before your
a divorce? ex does.
Offices in Manchester
and throughout the UK
Call 0808 175 7909
slatergordon.co.uk
Slater and Gordon (UK) LLP is authorised and
regulated by the Solicitors Regulation Authority.
Family | Employment | Estate Planning, Wills and Probate
Property | Crime | Dispute Resolution | Personal Injury
Feeling stressed?
Always tired?
Can’t concentrate?
No intimacy desire?
No energy?
It could be
your hormones
Blood profiling and hormone
restoration therapy can benefit
any person, any sex, at any age
Benefits to bioidentical hormone treatments for men and women:
• Improves
• Improves
• Improves
• Improves
energy levels
fat loss and muscle tone
sleep
memory and concentration
• Protects against heart disease
• Improves mood
• Decreases skin wrinkles
• Improves libido
You too could be happier in life
17 Cecil Rd, Hale, Altrincham WA15 9NZ l 0161 941 3212 l www.re-enhance.com
CLINICS:
CHESHIRE I LONDON I MAJORCA I YORKSHIRE
LIVINGEDGE | BROUGHT TO YOU BY THE PUBLISHER OF CHESHIRE LIFE | MAY 2018 | ISSUE 248 | livingedge.co.uk
Документ
Категория
Журналы и газеты
Просмотров
3
Размер файла
47 851 Кб
Теги
Living Edge, journal
1/--страниц
Пожаловаться на содержимое документа