close

Вход

Забыли?

вход по аккаунту

?

Основные результаты научной и научно

код для вставкиСкачать
Основные результаты научной и научноорганизационной деятельности
Учреждения Российской академии наук
Тихоокеанского института
биоорганической химии
Дальневосточного отделения РАН
за период 2006 - 2010 гг.
Акад. В.А. Стоник
История ТИБОХ ДВО РАН
Учреждение РАН Тихоокеанский институт биоорганической химии ДВО
РАН создано под названием Институт биологически активных веществ
СО АН СССР в марте-апреле 1964 г. на основании Распоряжения Совета
министров РСФСР № 4297-р от 03 октября 1963 г. и Постановления
Президиума Академии наук СССР № 79 от 06 марта 1964 г. Нынешнее
название Институт получил в 1972 г.
Институт входит в состав организаций, находящихся в ведении
Учреждения Российской академии наук Дальневосточного отделения
РАН. Научно-методическое руководство Институтом осуществляет
Отделение биологических наук РАН.
Численность
всего
из них
муж
Всего по штатному
расписанию
Всего научных работников, в
том числе:
академики
чл.-корр. РАН
доктора наук
кандидаты наук
без ученой степени
До 50 лет - 35,8%,
50-60 лет – 27,7%,
60-70 лет - 27,1%,
Более 70 – 9,4%
Возраст (лет)
До 29
жен.
137
30 – 39
лет
40 – 49
лет
49
50 – 59
лет
60 – 69
лет
37
Старше 70
лет
51
150
52
98
17
19
17
40
44
13
2
2
24
96
26
2
2
12
27
9
12
69
17
9
8
17
2
1
9
7
9
24
6
1
1
10
30
3
1
1
4
7
-
Возрастной состав научных сотрудников Института
В зависимости от среднего возраста
сотрудников научные
подразделения распределяются
следующим образом:
– до 39 лет – 2 подразделения;
– до 49 лет – 8 подразделений;
– до 59 лет – 6 подразделений;
– > 60 лет – 4 подразделения.
29 30- Ʃ до 40- 49- 60- > 70
39 39 49 59 69
Возрастные категории
390
370
350
330
310
290
270
250
2006
2007
2008
2009
2010
Годы
Общее количество сотрудников
Количество сотрудников
50
40
30
20
10
0
Количество сотрудников
Количество
сотрудников
Возрастной состав научных сотрудников
155
150
145
140
135
130
125
2006
2007
2008
2009
2010
Годы
Количество научных сотрудников
Средний возраст сотрудников полной занятости – 51 год
Основные научные направления Института
Институт осуществляет научную деятельность по шести
направлениям, утвержденным Постановлением Президиума РАН
№ 642 от 23.12.2008 г. и закрепленным в новой редакции Устава
Института:
• химические проблемы создания фармакологически
активных веществ нового поколения;
• структура и функции биомолекул и надмолекулярных
комплексов;
• биологическое разнообразие;
молекулярная генетика, механизмы реализации
генетической информации, биоинженерия;
• клеточная биология;
• биотехнология.
Тематика работ Института
2009-2010 гг.
•
«Новые фармакологически активные низко- и высокомолекулярные
метаболиты морских организмов. Выделение, структуры, синтез,
свойства и молекулярный механизм действия»
№ гос. регистрация 01.2.00 951074. Научный руководитель – академик В.А. Стоник.
•
«Хемотаксономическое исследование перспективных восточноазиатских
растений - источников для получения экдистероидов, алкалоидов,
полифенолов»
№ гос. регистрация 01.2.00 951073. Научный руководитель – академик П.Г. Горовой.
•
«Таксономическое и экологическое разнообразие, биотехнологический
потенциал гетеротрофных аэробных и факультативно анаэробных
морских бактерий и грибов-микромицетов»
№ гос. регистрация 01.2.00 951068. Научный руководитель – чл.-корр. РАН В.В. Михайлов.
•
«Биотехнологические исследования, направленные на создание новых
препаратов для медицины, сельского хозяйства и других отраслей»
№ гос. регистрация 01.2.00 951072. Научный руководитель – д.х.н. Э.П. Козловская.
•
«Изучение свойств и взаимосвязи между структурой и функцией
ключевых для морских организмов ферментов; создание оптимальных
генетических конструкций для экспрессии ферментов»
№ гос. регистрация 01.2.00 951070. Научные руководители – к.б.н. В.А.Рассказов, д.х.н. Т.Н.
Звягинцева.
•
«Изучение структуры и биологических свойств макромолекул и их
комплексов, включенных в патогенез наиболее распространенных и
социально значимых бактериальных инфекций»
№ гос. регистрация 01.2.00 951069. Научный руководитель – д.х.н. Т.Ф. Соловьева.
ТИБОХ ДВО РАН принимал участие в выполнении следующих
программ Президиума РАН и Отделения биологических наук РАН:
•
•
•
•
•
•
•
•
Программы Президиума РАН
2006–2008 гг.
Программа № 21 «Молекулярная и клеточная биология»;
Программа № 22 «Фундаментальные науки - медицине».
2009–2010 гг.
Программа № 21 «Молекулярная и клеточная биология»;
Программа № 22 «Фундаментальные науки - медицине»;
Программа № 27 «Основы фундаментальных исследований нанотехнологий и
наноматериалов».
Программы Отделения биологических наук РАН
2006–2008 гг.
Программа «Научные основы сохранения биоразнообразия России»;
Программа «Биологические ресурсы России: фундаментальные основы рационального
использования».
2009–2010 гг.
Программа «Биологическое разнообразие».
Виды проектов
2006 2007
2008
2009
2010
Всего
Проекты по программам
Президиума РАН
6
6
6
7
7
32
Проекты по программам
ОБН РАН
1
1
1
1
1
5
12
10
11
8
8
49
Интеграционные проекты
с СО и УрО РАН
Гранты Института
Виды программ
ФЦП фундаментальных
исследований
ФЦП «Кадры России»
Гранты РФФИ, всего:
2006
5
2007
3
2008
3
2009
3
2010
2
Всего
16
1
1
22
19
22
15
14
92
инициативные
9
12
11
12
10
54
РФФИ-региональные
9
5
3
2
2
21
ориентирован. фундамент.
исследования
международные
организация экспедиций
организация конференций
трэвел-гранты
1
1
1
-
-
3
1
-
1
-
1
1
1
1
-
1
1
4
1
1
2
3
1/0
1
1/1
-
-
МТБ
3
Гранты Президента РФ
3/2
(НШ/молод. ученые)
Целевые программы ДВО РАН -
1
2/2
-
1/1
3
8
8/6
3
Академики П.Г. Горовой, В.А. Стоник и чл.корр. В.В. Михайлов являлись получателями гранта
Президента РФ на поддержку ведущих школ. Возглавляемые ими школы входят в число
признанных научных школ Дальнего Востока России.
Некоторые результаты исследований Института в
2006-2010 гг.
Биоорганическая химия
•
Из морских беспозвоночных, водорослей,
бактерий и грибов выделено более 400
индивидуальных соединений, в том числе более
170 новых, для которых установлено химическое
строение, включая в ряде случаев абсолютную
стереохимию. К ним относятся полярные
соединения из морских звезд, тритерпеновые
гликозиды из голотурий, липиды, стероидные и
тритерпеновые гликозиды из губок,
сульфатированные полигидроксистероиды,
содержащие уникальные хлор- и иодфурановые
фрагменты, дитерпеноиды спонгианы, алкалоиды, Контрольные клетки
макролиды, пептиды и др.
•
Была обнаружена серия соединений,
усиливающих дифференцировку нейронов и рост
нервных отростков (нейритов). Установлено, что
изученные соединения проявляют значительный
синергетический эффект при совместной
обработке клеток фактором роста нервов (NGF) и
этими веществами. Изучаемые соединения
являются потенциальными биологическими
субстанциями для создания нейротрофных и
нейропротекторных препаратов, которые могут
Клетки, обработанные
быть использованы при лечении
нейродегенеративных заболеваний и травм
линкозидом L1, 7,5 мкМ, 5 дней
головного и спинного мозга.
Биоорганическая химия
Новые метаболиты и их свойства
O
NH
NH
O
O
H
O
N+
H
O
O
OH
N H2
O
H
N
O
O
N
OH
N
O
H
Vessel part
Новый гексациклический алкалоид
монанхоцидин из губки с ранее
неизвестной скелетной системой
высокотоксичен для опухолевых клеток,
стимулирует их программируемую смерть
(апоптоз).
N H2
Anchor part
O
Тетрациклический алкалоид
ОФИУРОИДИН из офиуры O. rosei –
мощный антиоксидант
Изоризохалин
из морской губки
Neu
Kdo
Kdo
GalA
GlcN
GlcN
Необычный ЛИПОПОЛИСАХАРИД из
морской -протеобактерии L. rosea.
Из губки Rhizochalina incrustata выделен новый
двухголовый сфинголипид изоризохалин.
Установлена его химическая структура, включая
абсолютную стереохимию всех четырех
хиральных центров, которая предполагает
стереодивергентный биогенез изоризохалина с
участием как D-, так и L-аланина.
Биоорганическая химия
Первый ингибитор ванилоидного болевого рецептора из
актинии Heteractis crispa
Структура APHC1: GSICLEPKVVGPCTAYFRRFYFDSETGKCTVFIYGGCEGNGNNFETLRACRAICRA
Биологическое действие
А - Модель тепловой стимуляции боли in vivo, тест
«отдергивания хвоста».
По оси абсцисс – время, прошедшее после инъекции
APHC1 (0.1 мг/кг),
по оси ординат – время реакции APHC1 на болевой
стимул, n =5.
Б, В - Действие APHC1 на TRPV1-рецептор. Аппликация
капсаицина и смеси капсаицина с ингибитором TRPV1рецептора, (А) природным APHC1 (концентрация 500 нM)
или (Б) рекомбинантным APHC1 (концентрация 300 нM).
Каналы активированы 2 μM капсаицина в течение 35 сек
(А) или 20 сек (Б) до отмывки ооцита, потенциал,
приложенный к ооцитам -50 мВ.
Пространственное строение
нового ингибитора и близкого к
нему ингибитора трипсина
Биоорганическая химия
Новый тип каррагинана из дальневосточных водорослей и
полезные свойства этих полисахаридов.
x-каррагинан
4
количество клеток в
1см3
540кДа
3
2
1
0
Tichocarpus
crinitus
0
1
2 acidophilus (без
3 каррагинана)
4
Lactobacillus
5
Lactobacillus
acidophilus с 0,2% k-каррагинана
время сквашивания,
ч
Каррагинан стимулирует рост бифидобактерий. Содержание
бифидобактерий в опытном образце с каррагинаном превысило
таковое в контрольном образце в 10 раз
Протективный эффект каррагинанов против действия ЛПС
Степень защиты зависит от
концентрации каррагинана,
времени и способа введения.
LD50 ЛПС возрастает в 2-3 раза
на фоне каррагинана
LPS
LPS + carrageenan
80
смертность мышей
%
Каррагинан увеличивает
продолжительность жизни мышей
на 20-40%
70
60
50
40
30
20
10
0
1
0,5
0.25
0.015
концентрация ЛПС мкг/мышь
0.008
Биоорганическая химия
Новые природные соединения из высших наземных
растений
Природные соединения из высших наземных растений Дальнего Востока России
изучаются в Институте с момента его основания. В 2006-2010 гг эти работы
велись, главным образом, в двух лабораториях Института: в лаборатории химии
природных хиноидных соединений (д.х.н. С.А. Федореев) и лаборатории
хемотаксономии растений (академик П.Г. Горовой). Широко известны
выполненные недавно в Институте исследования биологически активных
соединений пигментов нафтохиноидной природы из воробейника
краснокорневого, лигнанов и катехинов из тиса остроконечного,
изофлавоноидов и производных стильбена из маакии амурской, олигомерных
стильбенов из винограда амурского и др.
Биоорганическая химия
8
R 1O
O
7
4
1'
4'
O
2'
2''
3 ''
R5=
1''
R3
O
7'' 8'' 9''
OH
OH
6''-O-малонил
(6''-O-mal)
O-β-D-глюкопиранозил
(O-β-D-glc)
OR 4
3'
O
5''
4''
HO
HO
5'
5
R2
6''
R1=
6'
3
6
O
OR5
2
RO
dH-6=8.31,c
dC-6=153.9
O 6 H
dC=125.5
11b
3
6b
6a
11a
1
dC=114.2 H O 10a
dH-11a=6.06,c
dC-11a=101.1
O
O
Полифенолы из стеблей и клеточной культуры Vitis amurensis
OH
OH
R
HO
OH
OH
HO
2a
HO H
H
5a
6a
10a
5b
1a
HO
7a
8a 9a
10b
9b
12a
HO
14a
10a 11a
8b
7b
O
14a H
1b H
6b
OH
12a
12a
HO
14a
9a
H
8a
7a
2a
3a
6a
2b
HO
7b
8b
10a
5b
5a
3b
OH
6b
OH
HO
OH
3b
H
H
HO
3b
6b
2b
12a
10a
OH
5b
12b
HO
H
HO
14a
6a
5a
HO
2a
3a
14a
6a
7b
8b
14b
8a
7a
H O
6b
2b
7b
8b
H
HO
5a
2b
H14b
3b
12a
OH
3a
5b
2a
14b
8a
7a
H O
12b
3a
HO
OH
5a
H
3a
8b
8a
H
7b
2b
3b
OH
HO
OH
14b
7a
6a
14a
12b
12b
HO
H
2a
12a
H
6b
OH
5b
OH
Органическая химия
Органический синтез природных соединений
В 2006 -2010 гг. удалось разработать и осуществить следующие синтезы
природных соединений:
Усовершенствованный синтез эхинохрома А – активной субстанции
лекарственных препаратов серии «Гистохром»;
Синтез глабрухинонов А и В – биологически активных метаболитов
асцидии Aplidium glabrum;
Синтез структурных аналогов исландохинона – метоболита лишайника
Cetraria islandica;
Синтез дибромфаскаплизинов – токсичных для опухолевых клеток
соединений из морских губок;
Синтез эхинаминов А и В – метаболитов плоских морских ежей;
Синтез ломазарина и норломазарина – метаболитов высшего растения
Lomandra hastilis;
Синтез кристазарина – метаболита лишайника Cladonia cristatella;
Синтез аналога арноамина В – цитотоксичного алкалоида из асцидии
Cystodytes sp.;
Синтез корусканонов А и В - метаболита высшего растения Piper
coruscans;
Синтез этилиден-3,3‘-бис(2,6,7-тригидрокси-нафтазарина) – метаболита
морских ежей родов Spatangus и Strongylocentrotus и ряд других
OH O
синтезов.
O
O
O
OMe
OH
OH
Me
Me
O
Ph
Me
Me
O
Ph
O
O
HO
OR
OMe
HO
OH
O
OH HO
O
OH
OH
HO
OH
OH
O
Me
O
OH
Биохимия и молекулярная биология
Свойства, специфичность, механизм действия,
структура и функция ферментов морских организмов.
Была установлена методом молекулярного клонирования первичная структура эндо1,3-β-D-глюканазы из вьетнамской мидии Perna viridis:
VASWVYAPEPTRGPRRLRGAVMFRDDFNGGGLDTNNWNYEVSMYGGMNWEFQVYTNDKSNVYTNNGKLFLKPTKT
VDDPRWDENFLHSGVMDVAQIWGYCTQSAQYGCHREGKNGILPPVMSGKVKSKPVLKYGTVEVRARIPKGDWLWP
AIWMLPRDSHYGGWPRSGEIDIMESRGNVRASGHGVNEVSSTLHWGTSAGDNHYGQTTHAKQAADWSNSFHTWRL
EWTHDHIATFVDNQQILRVTPPSGGFSELGHTSNIWAGNDKMAPFDKEFYAIFNVAVGGTNGFFPENWDYGYPKPWSN
TSPHAAQDWWNGRSKWESSWQGDKVAMEIDYIEMRYL
Степень идентичности/гомологии эндо-1,3-β-D-глюканаз морских моллюсков (%)
Источник 1,3-β-D-глюканаз
M.yessoensis
C.albidus
L.sitkana
S. sachalinensis
P. viridis
Mizuchopecten yessoensis
100
86/93
49/64
45/60
53/68
100
50/63
45/58
53/66
100
54/66
Chlamys albidus
Littorina sitkana
Spisula sachalinenensis
Perna viridis
100
43/58
100
Биохимия и молекулярная биология
ФЕРМЕНТЫ МОРСКИХ ОРГАНИЗМОВ
•
Установлена первичная структура ДНКазы. Выявлена
высокая степень гомологии (67%) аминокислотной
последовательности фермента с нуклеазой, выделенной из
креветки Penaeus japonicus. Выявлена уникальная способность
этого фермента с заметно большей скоростью расщеплять
совершенно спаренные дуплексы ДНК в сравнении с
несовершенно спаренными дуплексами, имеющими замещение
даже одного нуклеотида
•
Установлена первичная структура α-галактозидазы из
морской бактерии Pseudoalteromonas sp. KMM 701,
терапевтический потенциал которой заключается в
возможности получения с ее помощью «универсальной»
донорской крови.
Молекулярная биология и молекулярная генетика
1
А
2
3
4
5
8
9
10 11
Б
Дифференциальная диагностика патогенных бактерий рода
Yersinia с помощью электрофореза продуктов полимеразной
цепной реакции с использованием ДНК, выделенных из
различных штаммов псевдотуберкулезного микроба (А),
энтероколитики (Б, колонки 1-5) и чумной бактерии (Б,
колонки 8-11).
Молекулярная биология
Изучение молекулярных механизмов действия биологически
активных веществ
Изучен молекулярный механизм противоопухолевого действия некоторых соединений.
Установлено, например, что индукция апоптоза фаскаплизинами зависит от каспаз-3, 8 и 9.
Total apoptotic cells (%)
A
3-Br-Fas
10-Br-Fas
100
C
None
1
2
Procaspase-8
Procaspase-9
80
60
Procaspase-3
40
PARP
20
BID
0
100
300
500
700
-Actin
1000
Concentration (nM)
( M)
Early apoptotic cells (%)
B
D
100
90.3
3-Br-Fas
None
10-Br-Fas
80
30.6
60
3-Br-Fas
40
20
60.1
10-Br-Fas
0
100
300
500
700
1000
Concentration (nM)
( M)
Рис. Тотальный (А) и ранний (В) апоптоз, индуцированный 3- и 10-бромофаскаплизинами в HL-60
клетках. Эффекты 3- и 10-бромофаскаплизинов на внутриклеточные уровни проапоптотических
белков (С), а также на проницаемость митохондриальной мембраны (D) в HL-60 клетках.
Молекулярная иммунология
Иммуногенные белки грамотрицательных бактерий
Установлена первичная и
пространственная структура
некоторых иммуногенных
белков поринов из бактерий
родаYersinia. На основе
бактериальных белковпоринов разработаны методы
диагностики опасных
инфекционных заболеваний –
иерсиниозов. Найдены
подходы к созданию вакцин
для защиты от этих
заболеваний.
ДИФФЕРЕНЦИАЛЬНАЯ ДИАГНОСТИКА ИЕРСИНИОЗОВ С ПОМОЩЬЮ
ВИДОСПЕЦИФИЧЕСКИХ БЕЛКОВ-ПОРИНОВ НАРУЖНОЙ МЕМБРАНЫ
БАКТЕРИЙ
ПРИЧИНЫ НЕОСЛАБЕВАЮЩЕГО ИНТЕРЕСА К
ЗАБОЛЕВАНИЯМ, ВЫЗЫВАЕМЫМ
ИЕРСИНИЯМИ
• Повсеместное распространение
и растущая заболеваемость иерсиниозом и
псевдотуберкулезом
• Выраженный полиморфизм клинических
проявлений и частое развитие осложнений
•
Иммуноферментные (ИФА) тестсистемы разработаны для
диагностики острых и вторичноочаговых форм иерсиниозов.
Определение антител к поринам
иерсиний в сыворотках крови больных
с поражением периферической
нервной системы
Антитела к порину из
Y. pseudotuberculosis и Y.enterocolitica
32%
больных
Количество исследованных
сывороток - 130
1 ряд – контроль;
2 ряд – больные
псевдотуберкулезом с
бактериологически
подтвержденным
диагнозом;
3 ряд – больные
кишечным иерсиниозом;
4 ряд - больные
сальмонеллезом;
5 ряд – больные
гепатитом
Определение антител к поринам
иерсиний в сыворотках крови
больных с поражением центральной
нервной системы
Антитела к порину из
Y.enterocolitica
20%
больных
Количество исследованных
сывороток - 55
Гликобиология и молекулярная медицина
Лектины, выделенные из морских беспозвоночных и водорослей –
уникальные молекулярные инструменты для исследований в
области гликобиологии
CGL
DTL
DTL-A
SVL-1
SVL-2
TCL
Мидия
Crenomytilus
grayanus
Асцидия
Didemnum
ternatanum
Морской
червь
Serpula
vermicularis
Красная
водоросль
Tichocarpus
crinitus
Специфично
сть
Gal/GalNAc
GlcNAc
GlcNAc/GalN
Ac
Маннаны
GlcNAc
PSM, Fet
3,5
Донор
Онкология
3
Концентрация СРБ, мг/л
Название
Источник
ИБС
2,5
2
1,5
1
0,5
0
ИФА
ТЛФА
Показано, что уровень лектин реактивных гликоформ в сыворотках
крови онкопациентов в 2,5 раза выше,
чем в группе доноров. В то время как у
больных ИБС не выявлено
существенной разницы в уровнях СРБ,
определенных ИФА и ТЛФА.
На основе использования лектинов разработаны способы
экспресс-диагностики раковых опухолей. Идет их апробация.
Молекулярная иммунология
О-специфические полисахариды. Разнообразие структур и
архитектуры иммуногенных бактериальных полисахаридов
Pseudoalteromonas agarivorans КММ 332
Установлена структура О-специфического полисахарида R-формы морской γпротеобактерии Pseudoalteromonas agarivorans КММ 332:
-D-ManpNAcA1
↓
4
3)-α-D-FucpNThrAc(13)-α-D-GalpNAc-(13)-α-L-Rhap(1
Одно из моносахаридных производных в составе полисахарида R-формы P.
agarivorans КММ 232 2,6-дидезокси-2-([N-ацетил-L-треонил)-амино-D-фукоза, ранее в
природе обнаружено не было
Рис. Электронная микроскопия. Общая морфология клеток штаммов
KMM 232 (a, b) и KMM 255T (c–e), показывающая клетки с одним жгутиком
и клетки, несущие два или четыре полярных жгутика.
Исследования биоресурсов
Таксономия морских
микроорганизмов
Чл.-корр РАН В.В.
Михайлов
Клетки Formosa agariphila sp. nov.
образовывали нити, которые
соединяли их друг с другом, и
почки на материнских клетках
(Рис.) . Это первое сообщение о
способности Cytophagaподобных бактерий к
размножению почкованием.
В ТИБОХ ДВО РАН выполняются
впечатляющие работы в области
таксономии морских микроорганизмов
(чл-корр. РАН В.В. Михайлов). В
частности, за период 2006 -2010 гг. в
более чем 40 научных статьях были
валидно описаны (с применением
молекулярно-генетических и
современных морфологических методов)
более 40 новых видов и 15 новых родов
морских бактерий, дана биохимическая
характеристика многих из них.
Исследования биоресурсов
«Химические, таксономическое и ресурсоведческое
изучение дальневосточных растений – перспективных
источников биологически активных веществ»
Содержание экдистероидов интегристерона A и 20-гидроксиэкдизона в
различных частях растений сем. Caryophyllaceae
Эпидерма листьев видов рода Megadenia
Megadenia speluncarum
Megadenia bardunovii
Megadenia pygmaea
Ультраструктуры
поверхности семянок
папилла Heteropappus saxomarinus
A – верхняя эпидерма, B – нижняя эпидерма
Биоиспытания и фармакология
OH
HO
20
12
3
g lc O
Противопухолевая активность гинзенозида Rh2 на мышиных моделях
карциномы легких Льюиса и меланомы В-16;
В эксперименте на мышах-самках линии С57Bl/6 с карциномой легких
Льюис показано, что введение гинзенозида Rh2 в дозе 10 мг/кг
привело к достоверному снижению массы первичного опухолевого
узла в 1,3 раза по сравнению с контролем. Количество и площадь
метастазов в легких мышей достоверно уменьшились относительно
контроля в 4,5 и 13,2 раза соответственно, при этом индекс
ингибирования метастазирования достигал 83%.
Биотехнология
Разработан способ выделения полифенольных
соединений из морских трав семейства Zosteraceae,
позволяющий получать значительные количества
розмариновой кислоты, природного антиоксиданта,
проявляющего противовирусную и антилейкозную
активность, и 7,3'-дисульфата лютеолина, нового
биологически активного агента, обладающего
канцерпревентивным действием и противовирусной
активностью.
Методами генетической инженерии получены продуценты
ряда ценных рекомбинантных белков, в том числе поринов
из бактерий рода Yersinia, которые можно использовать для
диагностики иерсиниозов, высокоактивной щелочной
фосфатазы из морских бактерий, ряда пептидов с
обезболивающим действием из актиний и других.
Инновационная деятельность. Прикладные исследования
Лицензирование препарата «максар», выпуск
его первой опытно-промышленной партии
серия
011207
021207
#
к-во упаковок
700
700
всего
Нормативные документы (НД)
серия
031207
041207
3600
к-во упаковок
700
1500
№ НД
Регистрация препарата МАКСАР
1
Инструкция по медицинскому применению препарата "Максар в лекарственной форме - таблетки,
покрытые оболочкой, 60 мг"
2
ФСП "Маакии амурской древесина ангро"
ФСП 42-0170-2947-02
3
Регистрационное удостоверение
P №003286/01 от 12.04.2004 г
4
ФСП "Маакии амурской экстракт сухой"
ФСП 42-0170-2948-02
5
Регистрационное удостоверение
P №003309/01 от 12.04.2004 г
6
ФСП "Максар таблетки, покрытые оболочкой, 60 мг"
ФСП 42-0170-3905-03
7
Регистрационное удостоверение
P №003294/01 от 12.04.2004 г
Лицензирование препарата МАКСАР
8
Разработан и согласован ОПЫТНО-ПРОМЫШЛЕННЫЙ РЕГЛАМЕНТ (ОПР-02698170-02-03) на
производство препарата "Маакии амурской экстракта сухого".
9
Разработан и согласован ПУСКОВОЙ РЕГЛАМЕНТ (ПУР 022698170-01-07) на производство препарата
"Максар таблетки, покрытые оболочкой, 60 мг".
10
Лицензии № 99-04-000243 от 31 октября 2006 г ТИБОХ ДВО РАН на производство, хранение и
реализацию препаратов: "Маакии амурской древесина ангро" и "Маакии амурской экстракт сухой
11
Лек. средства, разрешенные к промышленному выпуску и реализации на территории России:1.
Маакии амурской древесина ангро 2. Маакии амурской экстракт сухой. 3. Максар таблетки,
покрытые оболочкой, 60 мг
"
Инновационная деятельность.
• Подана заявка в ФГУ «Научный центр экспертизы средств
медицинского
применения»
с
целью
подтверждения
государственной регистрации этого лекарственного средства.
Получено заключение экспертизы и вновь подготовлено досье на
препарат, документы переданы в Минзравсоцразвития на
утверждение.
• Обнаружены новые свойства препарата «Максар®». Показано, что
он
обладает
антитромбогенным
и
антитромбоцитарным
действием. Курсовое введение препарата Максар, как и
проведение терапии этинилэстрадиолом, ограничивают процессы
перекисного окисления липидов, снижают общее содержание
липидов, и нормализуют вязкость крови. Препарат может быть
использован в качестве антиклимактерического средства.
Инновационная деятельность.
Медицинские препараты, ранее разработанные в ТИБОХ.
Разработан технологический регламент и утверждена
ФСП на препарат «Эхинохром, субстанция», RegWorkNx
53606, получено регистрационное удостоверение Р
N002362/01 от 20.07.2010. на право выпуска субстанции
на двух опытно-технологических участках института. В
2007-2010 г.г. выпущено 3 серии этой субстанции. На
основе эхинохрома ранее были разработаны и
внедрены в медицинскую практику 2 лекарственных
препарата. Выпуск этих препаратов в 2006-2010 гг был
продолжен. За отчетный период выпущено 9 серий
препаратов (около 100 тыс. упаковок), последняя стадия
производства выполнялась на арендованном у ЗАО
«Брынцалов А» оборудовании.
Перерегистрация медицинских
препаратов
В течение 2-х лет успешно выполнена экспертиза итогов клинического применения и
документации на медицинские препараты «Гистохром для офтальмологии».
«Гистохром для кардиологии» и «Коллагеназа-КК», а также на соответствующие
субстанции и исходные материалы. Подготовлены новые досье на эти препараты,
они переданы для окончательного заключения в Минздравсоцразвития.
Инновационная деятельность.
Государственный
контракт
Многолетние фундаментальные исследования природных соединений
02.522.11.2013 от
21 июня 2007 г
Новые лекарства, пищевые добавки, биопрепараты, функциональные
продукты питания
Опытно-экспериментальное производство
МЕДИЦИНА, ПИЩЕВАЯ ПРОМЫШЛЕННОСТЬ, КОСМЕТИКА
Инновационная деятельность.
СОЗДАНО И РАЗВИВАЕТСЯ ОПЫТНОЭКСПЕРИМЕНТАЛЬНОЕ ПРОИЗВОДСТВО Института
Участок органического синтеза
Участок экстракции
органическими растворителями
Участок готовых форм
Участок водной экстракции
Инновационная деятельность.
Кумазид Препарат из съедобной голотурии Кукумария японская. Мощный
иммуностимулятор с профилактическим и лечебным действием при
иммунодефицитах. Получена опытная партия. Успешно завершены
доклинические испытания. Оформляется разрешение на клинические испытания.
Максар – новое применение в качестве фитогормонального средства при терапии
пост-климактерического синдрома. Оформляется разрешение на клинические
испытания.
Гистохром синтетический для кардиологии Разработан синтез, получена опытная
партия биологически активной субстанции. Начаты доклинические исследования.
Коурохитин Разработан синтез активной субстанции и создана композиция с
сильным противовоспалительным действием и противоопухолевыми
свойствами (совместно с ДВГУ). Получена опытная партия , начаты
доклинические испытания.
Транслам Иммуномодулирующий и радиопротекторный препарат. Успешно
проведены доклинические испытания. Разрабатывается новая генноинженерная технология
Неомититилан. В качестве ранозаживляющего средства существенно превосходит
метилурациловую мазь. Получена опытная партия, ведутся доклинические
испытания
Количество публикаций
Данные Web of Science
160
140
120
100
80
60
40
20
0
всего
российск.
междунар
2006
2007
2008
Годы
2009
2010
Количества публикаций на
одного научного сотрулника
Публикации Института
Results found:
1,642
Sum of the Times Cited:
9,310
Average Citations per Item:
5.67
h-index :
33
1,2
1
0,8
0,6
0,4
0,2
0
2006
2007
2008
2009
Годы
Анализ публикационной активности ТИБОХ ДВО РАН в период 2006-2010 г.г.
(На рис. приведены данные по публикациям статей в рецензируемых
журналах).
2010
Количественные показатели результатов научной деятельности
Института
Виды деятельности
Общее количество публикаций
2006
2007
2008
2009
2010
Всего
301
234
267
228
242
1272
Статьи в рос. рецензируемых
47
67
49
76
100
339
журналах
Статьи в межд. рецензируемых
52
44
55
52
51
254
журналах
Статьи, всего
99
113
104
128
151
593
Отношение числа статей в
0,66
0,72
0,76
0,93
1,10
рецензируемых журналах к числу
научных сотрудников
Статьи в базе данных WoS
75
81
71
80
71
378
Отношение числа статей в базе
0,50
0,53
0,52
0,58
0,52
данных WoS к числу научных
сотрудников
Монографии
4
3
3
1
4
15
Полученные патенты
7
4
9
15
10
45
Защищенные диссертации (д.н. /
1/3
1/5
1/4
1/7
2/2
6 / 21
к.н.)
Присвоенные звания
0/1
0/0
1/0
2/0
0/3
3/4
профессора/доцента
Удельный вес договорных работ (в
17,8
34,7
29,8
24,6
11,1
27,4
% от общего объема
финансирования)*
- *В данный раздел включены хоздоговоры, ГК, гранты РФФИ, гранты Президента РФ.
Анализ цитируемости публикаций Института
Цитирование
Годы
1980 –
2001
2005
2006
2007
2008
2009
2010
2011
общее
9201
630
654
661
790
869
823
260
на научного
сотрудника
67,17
4,17
4,36
4,82
5,76
6,34
6,00
1,8
Анализ данных по цитированию последних публикаций Института
2005
2006
2007
2008
2009
2010
Всего
Кол-во статей в базе WoS
79
75
81
71
80
71
457
Кол-во цитирований
505
314
218
202
79
4
1322
Кол-во цитирований на
одну публикацию
6,39
4,19
2,73
2,45
0,98
0,05
Кол-во цитирований на
научного сотрудн.
3,37
2,08
1,42
1,47
0,58
Цитируемость некоторых научных сотрудников
Фамилия и научная степень
автора
Количество
публикаций в
базе WoS
Общая
цитируемость
Цитируемость
публикаций
2005-2010 г.г.
академик Стоник В. А.
282
2083
294
чл.-корр. РАН Михайлов В. В.
143
1654
346
д.х.н. Калиновский А. И.
189
1220
186
д.б.н. Иванова Е. П.
100
1233
137
д.б.н. Недашковская О. И.
78
773
298
д.х.н. Соловьева Т.Ф.
120
598
51
д.х.н. Макарьева Т. Н.
76
577
61
д.х.н. Калинин В. И.
51
574
86
к.х.н. Денисенко В. А
127
559
113
к.б.н. Фролова Г. М.
52
554
177
к.х.н. Дмитренок П. С.
114
539
237
д.х.н. Звягинцева Т. Н.
84
538
140
д.б.н. Романенко Л. А.
54
511
103
Место публикаций Института в рейтинге публикаций институтов ДВО
РАН
Число статей в изданиях, индексируемых
базой WoS, за 2006-2010 гг. в сравнении с
2010 г., на 1 н. с. Институты ранжированы
по среднему за 5 лет показателю.
Доля статей в рецензируемых изданиях в общем количестве
публикаций 2010 г. (без учета книг, патентов и т.п.). Прямые линии
– среднее значение по ДВО: верхняя – доля публикаций в
рецензируемых изданиях, нижняя – индексируемых в
международных базах данных (Web of Science и Scopus).
Некоторые публикации в научных журналах высокого уровня:
Ligand of scavenger receptor –class A indirectly induces maturation of human
blood dendritic cells via production of tumor necrosis factor-alpha by Jin et al.
Blood, 2009, 113,23,5539 Impact factor 10,55
Genome analysis of the proteorhodopsin-containing marine bacterium
Polaribacter sp. MED 152 (Flavobacteria) by Gonzales et al. Proc. Natl. Acad. USA,
2008, 805,123, 8724, Impact factor 9,43
Resonant electron capture by some aminoacids and their methyl esters by
Voinov VG et al. J. Am. Chem. Soc. 2006, 128, 18, 5506, Impact factor 8,58
Analgetic compounds from sea anemone Heteractis crispa is the first polypeptide
inhibitor of vanilloid receptor (TRPVI) by Andreev VA et al. Journal of Biological
Chemistry, 2008, 283, 35, 23414, Impact factor 7,385
Monanchacidin, a new polyclic guanidine alkaloid from the marine sponge
Monanchora pulchra by Guzii AG et al. Organic Letters, 2010, 12, 19, 4292. Impact
factor 5,42
Dactylone inhibits epidermal growth factor-induced transformation and phenotype
expression of human cancer cells and induces G1-S arrest and apoptosis by
Fedorov SN et al. Cancer research 2007;67(12):5914-20 Impact factor 5,33
Научные и государственные
награды
•
•
•
•
•
•
•
•
В отчетный период лауреатами премии ДВО РАН имени
выдающихся ученых Дальнего Востока России (биоорганическая химия
– премия им. академика Г.Б. Елякова) стали следующие сотрудники
Института:
2007 г. – к.х.н. А.С. Сильченко (молодежный конкурс – до 35 лет);
2008 г. – к.х.н. Т.А. Кузнецова;
2009 г. – к.х.н. Е.Г. Ляхова и С.А. Колесникова (молодежный конкурс);
2010 г. – д.х.н. Т.Н. Макарьева.
К.б.н. Рассказов В.А. был награжден медалью ордена «За заслуги перед
отечеством» II степени за вклад в развитие отечественной науки и
многолетнюю плодотворную деятельность; вед. инженер Логунов
Александр Васильевич награжден нагрудным знаком «За содействие
МВД России» (2010 г.)
Ряд сотрудников получили Почетные грамоты, премии и награды
(медали) от Краевой администрации, Думы Приморского края, мэрии
Владивостока.
Акад. В.А. Стоник избран почетным доктором (Doctor causa)
Вьетнамской академии наук и технологий (2010 г.).
Правовая защита объектов
интеллектуальной собственности
По состоянию на
31.12. 2010 г.
действует 80
патентов РФ на
изобретения, 10
зарубежных
патентов, 11
свидетельств на
товарные знаки. За
отчетный период 36
патентов РФ на
изобретения и 2
зарубежных патента
прекратили
действие по причине
истечения срока
действия, либо
коммерческой
нецелесообразности
дальнейшего их
поддержания в силе.
Юридические действия /
годы
2006
2007
2008
2009
2010
Всего
Количество заявок на
изобретения
11
12
10
16
14
63
Количество патентов на
изобретения
7
4
9
15
10
45
Количество заявок на
товарные знаки
-
-
-
-
-
-
Количество полученных
свидетельств на
товарные знаки
1
-
-
-
1
Количество патентов на
изобретения,
прекративших действие
1
4
8
21
2
36
Количество действующих
зарубежных патентов
7
11
11
12
10
Научно-экспериментальная база
Спектрометр ЯМР, Bruker, Avance-III, 700, введен в эксплуатацию 31.05.2009 г.
Времяпролетный МАЛДИ-ТОФ-ТОФ масс-спектрометр ULTRAFLEX-III (2009г.)
ДНК – секвенатор «ABI Prism 3130Х Genetic Analyzer» («Applied Biosys-tems»,
США) введен в эксплуатацию 19 мая 2010 г;
БЭТА-СЧЕТЧИК TRI-CARB (2007г.)
ХРОМАТОГРАФ МИЛИХРОМ А-02
Проточный цитофлюориметр FACSCalibur
Секвенатор белков Procise 492 cLC
Показатели работы аспирантуры
Показатели работы аспирантуры
2006
2007
2008
2009
2010
Прием аспирантов, чел.
1
6
5
12
6
Количество аспирантов на конец
отчетного года
15
11
10
22
21
Выпуск из аспирантуры
2
8
2
3
6
Выпускники аспирантуры, зачисленные
в штат Института
2
7
2
3
6
Защищено в диссертационном совете
кандидатских диссертаций
(всего/аспирантами и соискателями
Института)
3/2
5/1
4/4
7/1
2/1
Основной поставщик молодых кадров – Отделение биоорганической
химии и биотехнологии ДВФУ
Международная
деятельность
Мероприятие
2006
2007
2008
2009
2010
Участие
Института
в
долгосрочных
международных программах
1
2
2
2
1
Международное сотрудничество
двусторонних соглашений
рамках
6
8
8
4
6
Количество проведенных на базе Института
международных мероприятий
-
1
1
-
-
Участие
Института
в
международных
мероприятиях,
проведенных
другими
организациями в России.
19
31
20
10
11
Число загранкомандировок
13
14
12
13
8
Принято зарубежных ученых
18
31
20
17
40
Совместные морские экспедиции
-
1
-
-
1
Стажировки ученых за рубежом
-
-
-
2
2
Стажировки иностранных ученых в Институте
-
-
4
3
2
12
12
8
7
13
1
1
1
1
в
Участие ученых в зарубежных конференциях
Количество
выполняемых
международным грантам
работ
по
Совместные научные исследования с
зарубежными партнерами
Необходимо отметить результаты, полученные в рамках следующих соглашений:
1. Университет штата Миннесота, Институт Хормел (Остин, США, 2001 г.).
Опубликованы пять статей.
2. Институт химии биологически активных веществ Национального центра
исследовани (Неаполь, Италия, 2003 г.). Совместные исследования природных
морских соединений. Опубликованы четыре статьи.
3. Орегонский государственный университет (США). Установление структуры
морских природных продуктов с помощью масс-спектрометрии. Рег. № 265 от
29.06.2005 г. Опубликованы восемь статей, оформлен совместный патент.
4. Медицинский Исследовательский центр молекулярной терапии рака Донг-A
университета (Пусан, Южная Корея). Поиск и всесторонние исследования
противоопухолевых препаратов. Рег. № 492 от 14.11.2005 г. Получено два патента.
Опубликованы восемь статей.
5. Чусун Университет, Колледж фармакологии, лаборатория биохимии (Гуанг
Джу, Южная Корея). Исследованию фукоиданов и ламинаранов: Рег. № 357 от
14.12.2006 г. Опубликованы две статьи.
6. Институт химии природных продуктов ВАНТ (Ханой, СРВ). Совместные
комплексные исследования морских природных соединений из морских
биологических объектов, обитающих во Вьетнамских и Дальневосточных морях: Рег.
№ 507 от 29.12.2008 г. Опубликованы пять статей.
Экспедиции
2007 г
Российско-Вьетнамская экспедиция на борту НИС «Академик Опарин» (рейс № 34)
организована ТИБОХ, ИБМ и ИАПУ ДВО РАН совместно с Институтом Океанографии
(ИО) Вьетнамской академии науки и технологии (ВАНТ)
Основная цель:
всестороннее исследование коралловых рифовых сообществ шельфа Вьетнама
(провинция Кнань Хоа) и нескольких районов в Южно-Китайском море, включая сбор и
идентификацию макро- и микроорганизмов для поиска новых источников
биологически активных метаболитов. В работе экспедиции принимали участие 31
представитель институтов ДВО РАН и 5 научных сотрудников ИО ВАНТ.
2010 г.
ТИБОХ и ИБМ ДВО РАН при содействии Вьетнамской академии науки и технологии
организовали и провели совместный Российско-Вьетнамский экспедиционный рейс №
38 на борту НИС «Академик Опарин» в территориальные воды Социалистической
республики Вьетнам. Впервые Вьетнамская сторона внесла свой вклад в
финансирование экспедиции. Продолжительность рейса составила 55 суток. В работе
экспедиции приняли участие 29 представителей институтов ДВО РАН и 10 научных
сотрудников из четырех институтов ВАНТ во главе с руководителем группы к.б.н.
Тринь Тхэ Хью. По окончании рейса в Институте химии природных продуктов ВАНТ
(Ханой) была проведена Международная Конференция по морским биологическим
ресурсам Вьетнама «Российско-Вьетнамская экспедиция: Морские биологически
активные соединения и биоразнообразие Вьетнама».
БЛАГОДАРЮ ЗА ВНИМАНИЕ
Документ
Категория
Презентации
Просмотров
36
Размер файла
15 290 Кб
Теги
1/--страниц
Пожаловаться на содержимое документа